SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1E7XRL4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1E7XRL4
Domain Number 1 Region: 213-389
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.07e-53
Family B3/B4 domain of PheRS, PheT 0.0000574
Further Details:      
 
Domain Number 2 Region: 478-692
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.95e-46
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0001
Further Details:      
 
Domain Number 3 Region: 35-190
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.57e-42
Family Myf domain 0.004
Further Details:      
 
Domain Number 4 Region: 700-798
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 3.66e-22
Family Anticodon-binding domain of PheRS 0.001
Further Details:      
 
Domain Number 5 Region: 414-486
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 4.39e-16
Family Domains B1 and B5 of PheRS-beta, PheT 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1E7XRL4
Sequence length 799
Comment (tr|A0A1E7XRL4|A0A1E7XRL4_9PROT) Phenylalanyl-tRNA synthetase beta subunit {ECO:0000256|HAMAP-Rule:MF_00283} KW=Complete proteome OX=160808 OS=Acidithiobacillus ferrivorans. GN=A4U49_11145 OC=Acidithiobacillaceae; Acidithiobacillus.
Sequence
MRVSIQWLRELLDTSWDTEEIAQRLTMGGIEVEVVEDAAPAFHGVVVAAIQSVVCHPEAD
KLRVAQVDVGDGRLRTIVCGADNLAVGQRVPLAMPGAGLPGDRDIVIAALRGIASEGMLC
AAAELGLDDGSSGLLILDADAPIGADLRDYLGLDDQVLTLGITPNRGDALSVLGVARDLC
ALGAGTLRNPLEPMAKCSWVTSGPEEGSSTPDDFPVHIATAAQSACPSYTALWIDGVPQR
LPDRLHERLRRAGQRCIHPVVDLLNLHMLETGQPLHAFDAETLQGGLSIRWAQDGEILDA
LDGRDLPLASDMLVIADRAGPVALAGVIGGRRTAVSAQTHSIVLESAFFQPKVIQGRARR
LGLQTDAAMRFERGVDFALAPRVAAAVLTRLAILGKADLRATRSHTVLGQLPEHAPITLR
RARLARILGMDYEDTVVETALTRLGLRVSEIPDGWQAISPSHRFDLHIEADLIEEVGRIY
GYERLPAHRPVGTLQPLAMARGPQPTTLRGILQARDYHEVITYSFISRQAQDVFTPDADA
PALLNPLSTDLAVMRASLWPGLMQALQFNVKRQQDRVRIFELGRVFSANDQHLVLGGCMV
GAADRESWAQPQRAADFYDLKGDVSALLTLWPQTEFSFRPLANHPALHPGQAAEIWVADQ
RVGMLGALHPTLAAECDLDKSPFFFYLDIECLDGLVNVSRFTPLSPFPALRRDMALVIPD
DILAGTVLNVMRLSASGMVKEITIFDRYQGASLMVGTYSLAFALLLQDAERTLTDADVQA
EMDRLLVAVQRLGSIGLRA
Download sequence
Identical sequences A0A1E7XRL4 G0JQI3
WP_014029872.1.78061 gi|344200622|ref|YP_004784948.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]