SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1F1N7S1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1F1N7S1
Domain Number 1 Region: 127-317
Classification Level Classification E-value
Superfamily ITPase-like 4.71e-62
Family ITPase (Ham1) 0.00000869
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1F1N7S1
Sequence length 324
Comment (tr|A0A1F1N7S1|A0A1F1N7S1_9STRE) Nucleoside-triphosphate pyrophosphatase {ECO:0000256|HAMAP-Rule:MF_01405} KW=Complete proteome OX=1739381 OS=Streptococcus sp. HMSC072D03. GN=HMPREF2877_04310 OC=Streptococcus.
Sequence
MTKSIFEYKDEQDWYLASFGNYNHLTCFGGDEAYEQFVDFFQALTNVLAVSGFQLHIAKH
SSDLRLVSFILDCLKEETGRDLAVTQHQGALVVSEGDKLVYVHVPREGVALSDFFGSDNK
SDFGDVLLIATRNEGKTKEFRKLFGKLGIKVENLNDYPDLPEVAETGMTFEENARLKAET
ISELTGKMVLSDDSGLQVDVLGGLPGVWSARFAGPDATDDENNAKLLHELAMVLDDSKRT
ANFHTTLVVAAPGRDSLVVDADWKGYIGREPKGDNGFGYDPLFLVGNTGKTAAELSAEEK
NEQSHRGQAVKKLMEVFPAWQNKQ
Download sequence
Identical sequences A0A1F1N7S1 A0A1W5ZD26 F8HGM0 G2GQP2
gi|387762042|ref|YP_006069019.1| WP_002886529.1.10057 WP_002886529.1.23906 WP_002886529.1.62478 WP_002886529.1.97787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]