SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1G4GW53 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G4GW53
Domain Number 1 Region: 24-168
Classification Level Classification E-value
Superfamily MIR domain 2.49e-27
Family MIR domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1G4GW53
Sequence length 224
Comment (tr|A0A1G4GW53|A0A1G4GW53_PLAVI) Dolichyl-phosphate-mannose protein mannosyltransferase, putative {ECO:0000313|EMBL:SCO66824.1} KW=Complete proteome OX=5855 OS=Plasmodium vivax (malaria parasite P. vivax). GN=PVC01_080015600 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MSHYRFFVRVFLFSFLFFKVHSCLHVTDGSSIILENVGTSYKLFSTDMKWGSGSGNQLVT
AIKTNKNEENLLWTVNIYDEVKSFTGNKINCDEIVTLKHVKSNGYLMGSSHDSILSNNYE
LSVHQSKESGKFQVICENKKNSPYWSLGENIYLKSVDHNGYVSASKSYEFNQYNCHNCPI
LYHLEACIMRYTYPRDEQKWRAKSGVIITQFNDERGEKFNGDEL
Download sequence
Identical sequences A0A0J9SFY7 A0A0J9SVU1 A0A0J9TF86 A0A0J9WE55 A0A1G4GW53 A5K7D2
gb|PVX_094755 5855.PVX_094755 XP_001614418.1.43797 gi|156096769|ref|XP_001614418.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]