SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1G4I8R8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G4I8R8
Domain Number 1 Region: 81-233
Classification Level Classification E-value
Superfamily ApbE-like 0.00000889
Family ApbE-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1G4I8R8
Sequence length 710
Comment (tr|A0A1G4I8R8|A0A1G4I8R8_TRYEQ) Uncharacterized protein {ECO:0000313|EMBL:SCU68464.1} KW=Complete proteome OX=5694 OS=Trypanosoma equiperdum. GN=TEOVI_000664700 OC=Eukaryota; Euglenozoa; Kinetoplastida; Trypanosomatidae; Trypanosoma.
Sequence
MLSWNPESYVSEAVSRILAEEAKQGRGGAIPSYYDAVTSHLEAHELSKSIKVALEEQRRQ
NIGISCDIGGNVLEILFNPVDIEDAGVAEERVKKCVADIGCLFGNVSDELNSLNGKSGLV
AVSEDVLDILHHLQSMGLLTNFRFNPVSEKLGCILSATDRSSILKSMVLYNSQVEWPKGM
TLNFTDYMKAWLVDRVAARLEVLNEHRGCLIRLEDFARVFGTSRGSSVWKYGVSVSDLDG
EQKFIGCLELDALRPTAAAHAVEDPFFDHLGMQSCVACCRTTTTSYCLANALSVCSHGEK
ALFFVREWREVNGPESKDSLLSFTLYFGYGKPISDEGDVRIGENDDKRIYLHSEKDQIVR
TYKQMGDVKRYESHVETVIANSKNADLFHNISGYIGETTCENLERAMSLFPRMCVVASCI
GNENAVCVSVLKAADVLRGDATFVFCISQRSPLFNHVFAPRSQVTLNFLFDNAQAVCQAI
NDTYPLWINETGNEPVVFESESRTYVTTKALMDISKQVAFETAESFLVGEEVLVVGRCLD
SIPSTVVINVKNTLVLQDHVPPQEFYPFLFTIVHKIYGTVGFVGYGCQLCSLSPLTMYIY
SPIESSQFALDEVYTGPKCNLTFLSSFGAPIFDGKDFEELGCGMPMAASSVSSLPQQNIY
FQVEGMLIRIVRDISDKYVICVVAANECRFNQTDPCKLLVRPDDERLIPA
Download sequence
Identical sequences A0A1G4I8R8 Q581Y7
XP_847028.1.54365 5691.Tb927.8.1950 gi|72392455|ref|XP_847028.1| Tb927.8.1950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]