SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1G6B652 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1G6B652
Domain Number 1 Region: 4-264
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.25e-80
Family Protein kinases, catalytic subunit 0.00000109
Further Details:      
 
Domain Number 2 Region: 379-441
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000101
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0092
Further Details:      
 
Domain Number 3 Region: 447-508
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000314
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1G6B652
Sequence length 669
Comment (tr|A0A1G6B652|A0A1G6B652_EUBOX) Serine/threonine protein kinase {ECO:0000313|EMBL:SDB16127.1} KW=Complete proteome; Reference proteome OX=1732 OS=Eubacterium oxidoreducens. GN=SAMN02910417_01225 OC=Eubacterium.
Sequence
MLNVGTFLADRYEVIGKIGTGGMSDVYKAKDHSLGRNVAVKVLKDEFADDVNFVTKFRSE
AQSAAGLEHPNIVNIYDVGSENGLHYIVMEYVEGITLKTYIEKKGQLTYKEAVSIAIQVG
RGIEAAHNKNIIHRDIKPQNIIISTEGKVKVTDFGIARAASANTINSDVMGSVHYSSPEQ
ARNGFVDGKSDVYSLGIVMYEMVTGRVPFDGDTTVAVAIQHLQEDMVSPSAYAPDLPISI
EKVILKCTQKSADRRYESMADLLVDLKKVLISPNEDFVTMVPLDNDKTRVITEDELRQIQ
EEADQTDTELTDAENEEEDEDGAINPRMEKLMTILGIVAAIIIVIVVILIIAKLAGGLNF
GSSDDEDTTTAVEQENEKVTMIDLTDMSYDAAEDALEELGLTIKNGGTVSSDTIDEGNVV
SQDVEEGEEISKGSTVTVTLSSGAGEISVPDVTGYEESSAINTLEDKGLKYTREYEYSDS
VESGKVISTDPAAGSSVKEGDTITITISQGVETVQVPDVTGKTKKKAKAALESAGLKLGN
VTSEYSDSVAKGKVISQGVASGKYVDSGTSVSIVVSLGPETVTYSFSTKITLPESSDNEV
KSANITLYDNSGNVLSSWNGVSASKFGSSGYSISVSDITSSKKGKLVIEWILEDGSTSTQ
TESVTFTKD
Download sequence
Identical sequences A0A1G6B652
WP_090173284.1.4507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]