SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1H0TPG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1H0TPG5
Domain Number 1 Region: 540-948
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.67e-37
Family alpha-mannosidase, C-terminal domain 0.014
Further Details:      
 
Domain Number 2 Region: 130-292
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.00000000000000637
Family alpha-mannosidase 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1H0TPG5
Sequence length 971
Comment (tr|A0A1H0TPG5|A0A1H0TPG5_9SPHI) Glycosyl hydrolases family 38 N-terminal domain-containing protein {ECO:0000313|EMBL:SDP55952.1} KW=Complete proteome OX=1881048 OS=Mucilaginibacter sp. OK268. GN=SAMN05428975_1802 OC=Sphingobacteriaceae; Mucilaginibacter.
Sequence
MKRRQFGIKNFCLITILFLLSTAATGVYGQKAQPAFTSITLQPTVAYVKYHGENRRVARL
LFRNGKSYNAGTLSVSFNNHTDNIAIPASTTGLEVFEVPLPGSAIKIATQATVTLTYNGQ
TYTARCIMEPARDNWSVYVLPHSHVDIGYTNTQAKVLKLHMDNIDESIDLAEKTQNYPAE
ARFKWTTEAIWVVDNYLKQANAEKKARFWNAVKKGWISLDGAYGNINTSMTDSRQLMQMF
AKSQKLAREQGIEIHTMFQGDVPGASWGLAAQAEQTGIHYFLSGPNASDRIGNLAKWQDK
PFYWLSPSGKQKLLFWQCQPYSIGYRLKGTKIPNFFTIDDPKPYYTGHPEENFLNPYLFQ
YLGDLEQNNFPYNMTILTWAMSDNAPIDPELPDAVKAWNEHYTSPKLIITSVKQFFNDLE
KQYKNEIPSFSGDYTEYWTDGVSSAARETALSRITSDRLKQTGAIWAIRNKPAYPVAAFD
DTWKNLLLYNEHTWGAYNSVGEPDNEKVKSEWNVKQGYVLRAEKQVDSLMTEALKPSATQ
ANAIDIYNTTNWPRTDVVYVPASLSKTGDLVKDATGKKIPSQRLSSGELAFVANAVPALG
KKTYTIHAGKAFNNGQAKINGNSLSNGIYTLTVDAKSGNIIKLIRGASGRNYVAADSAGL
NQYMYMPGDSLKKLVSTSNTHISIKEKGPLVVSMLIISDAPGTKGITREVRLVSGLDQVE
IINTIDKTAIRRKESIHFAFPFNVPGAQVRYSIPWGSARAEADQLPYANHNWFTMQRWVD
VSNSAYGITWSSPDAPLFEIGNITTGNLLGGLHHAPQWLSFTPQSPVLYSWVMNNLWHTN
FRADQEGKATFHYFMQAHESGFNSFKANQTGLNNHQPLIVSAATSAPEKGLFFKIDGESI
YIEAIKPTDDGLGVIIQLVNSSDIDSEAAITPNTVAAIKIWESNLMEDKLKELGSHFTIP
AKGVLSVRVDK
Download sequence
Identical sequences A0A1H0TPG5
WP_090466955.1.24149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]