SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1H3VU68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1H3VU68
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.79e-31
Family Sfri0576-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1H3VU68
Sequence length 114
Comment (tr|A0A1H3VU68|A0A1H3VU68_9PROT) SpoIIAA-like {ECO:0000313|EMBL:SDZ78385.1} KW=Complete proteome OX=1231 OS=Nitrosospira multiformis. GN=SAMN05216411_101380 OC=Nitrosomonadaceae; Nitrosospira.
Sequence
MITIEETENLISIAVFGEFTLADYQEFEDKVLRKAGREGKVNVLFDWRDMLSYTIDVAWE
DIKFVREHGSEFNRIAIITENQWRAWAAWVSNLFVDADIRVFRDYAAAKTWLEG
Download sequence
Identical sequences A0A1H3VU68 Q2YCI1
gi|82701366|ref|YP_410932.1| 372708 WP_011379594.1.10075 WP_011379594.1.92891 323848.Nmul_A0232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]