SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1I1PFJ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I1PFJ5
Domain Number 1 Region: 97-409
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.13e-61
Family Carboxypeptidase T 0.031
Further Details:      
 
Domain Number 2 Region: 611-685
Classification Level Classification E-value
Superfamily PKD domain 0.0000000000000288
Family PKD domain 0.0018
Further Details:      
 
Domain Number 3 Region: 551-603
Classification Level Classification E-value
Superfamily PKD domain 0.000000131
Family PKD domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1I1PFJ5
Sequence length 720
Comment (tr|A0A1I1PFJ5|A0A1I1PFJ5_9GAMM) PKD domain-containing protein {ECO:0000313|EMBL:SFD08611.1} KW=Complete proteome; Reference proteome OX=1123010 OS=Pseudoalteromonas denitrificans DSM 6059. GN=SAMN02745724_03437 OC=Pseudoalteromonadaceae; Pseudoalteromonas.
Sequence
MTLINALTFAASLTLSSSSPSVYLAEFSDQKQKIKTKISFHHALLASEDDGLLLELTNKE
VRLLEKKGITLTAADKKWQKKLSTIQRRSSANQMGGIPGFNCYETVEETFTEADKLVIQN
PNLAQWIDIGDSWQKINGDKGYDLKVLKIGKQSLIDPPILFIQSAMHAREYTTAALTLDF
AKNLLQNYDSDPDINWILNRHQIHILFQTNPDGRKIAETGVFQRKNVNINHCSQGHTGID
LNRNFSFGWNTVDGGSSGNDCDETYRGTHPASEPEVSAIEAYVRSIYPDVRGESDTDAAP
IDTKGLYLDIHSYSELILWPFGHTETLAPNNKGLQALGRKLAYFNGYDPGQSVGLYPTDG
TSDNLAYGELGIAHITFELGTAFFQSCNIYNNKIKPDNLKALLYAAKAVEAPYLITSGPD
IASIEITDADDIYITIDVLATDEQFSTKGGIEAKQNINKVWYSIGAYPNEENSLQAEIKD
GAADTSKEVFTARIKRDDLVNDQITVYFKGEDSSNSQGPVSAKTLTLSQPIANADINCQG
AKCHLLGKEIANSYLWQLEDGRTSINKATDFIFPSLGSYQATYTVTNSIGLHTTQNYDFT
VTELLKPDIKFSAICSNITCKFDASDTIDLDSDNLIYKWDFGDSTYSDTMVTSHDYASTG
NFTVTLTVTDEHNQTSVLTQEIITTQVVTQEPTLEKTQSSGGSFIYNLLILIVFLRVKHK
Download sequence
Identical sequences A0A1I1PFJ5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]