SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1I3RJM1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I3RJM1
Domain Number 1 Region: 7-275
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.2e-79
Family Protein kinases, catalytic subunit 0.0000000347
Further Details:      
 
Domain Number 2 Region: 512-572
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000034
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 
Domain Number 3 Region: 448-506
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000051
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1I3RJM1
Sequence length 619
Comment (tr|A0A1I3RJM1|A0A1I3RJM1_9ACTN) Serine/threonine protein kinase {ECO:0000313|EMBL:SFJ46042.1} KW=Complete proteome OX=324952 OS=Streptosporangium canum. GN=SAMN05216275_10947 OC=Streptosporangium.
Sequence
MTQPRRLGDRYELDGVVGRGGMAEVYRARDIRLDRIVAIKTLRADLARDHIFQARFRREA
QSAASLNHPSIVAVYDTGEDVAGSAPVPYIVMEYVDGRTLRDLLRADRRLLPERAAELVD
GILRALDYSHRGGIVHRDIKPANIMITNNGDVKVMDFGIARAMADSAATMTQTAQVIGTA
QYLSPEQARGERVDARSDIYSTGCVLYELLTGQPPFTGDSPVAIAYQHVREDPIPPSQID
PEIPKWADAIVLKAMAKDPAHRYQSAGEMRADIQRAMSGIPMDAQTMALANNYGSATRTM
QTPGPGGPATQRTTAVPAYEYGTEEGGGRGERGRRRQQSNGNTAVKTAAWILVPLLVIGA
FIGVGYMFLSSPGDSDAANKVKIPALTSRTEAAASKALTDLGLTVKTVEKFDEESEKGTV
IETSPAAGTAVDKGSEVTLTVSKGVEKAEVPNVVNMTTDEAKAALEEAGFVPSVRTKASS
GPQDKVLETKPEAGKKADKGSTVLVYVPKEAVEVPGVASLTVNDAKRMLKEAGFKYKVVE
QESDLPEGTVLSQAPEAGAKLQQGTTITLVVSSGQAPQPTAPPTTEPTQEPPITEEPEPD
PTETEDPFFNEAPSDDLGG
Download sequence
Identical sequences A0A1I3RJM1
WP_093887683.1.4528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]