SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1I3RSY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I3RSY1
Domain Number 1 Region: 10-159
Classification Level Classification E-value
Superfamily Resolvase-like 1.01e-22
Family gamma,delta resolvase, catalytic domain 0.001
Further Details:      
 
Weak hits

Sequence:  A0A1I3RSY1
Domain Number - Region: 186-221
Classification Level Classification E-value
Superfamily Homeodomain-like 0.034
Family FIS-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1I3RSY1
Sequence length 237
Comment (tr|A0A1I3RSY1|A0A1I3RSY1_9EURY) Site-specific DNA recombinase {ECO:0000313|EMBL:SFJ48397.1} KW=Complete proteome OX=44930 OS=Natronobacterium gregoryi. GN=SAMN05443661_13329 OC=Natronobacterium.
Sequence
MAQSDTKSTLIYARVSTEDQDLSHQEENLWNYATDSLGFPEDDIDVLRDKSTGTNIDRSG
YREMMERVRAGDAESIIVREISRIGRDIRDIHDTVYEIVDDHDCGLYIKNDGLEVDADEE
LDIAFKSTMFGLSLAAEIKAKKVKENTLEGLRAAEQAGKCTTRPPYGFTTDDEGYLQPTD
EFSNAREAIEAVEELGWSHRKTARHTGVPRRTIPNILERKDLYLTTTIDRGDPGESA
Download sequence
Identical sequences A0A1I3RSY1 L0AKQ0
WP_005580380.1.6326 WP_005580380.1.71579 WP_005580380.1.8181 gi|429192523|ref|YP_007178201.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]