SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1I4WWK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I4WWK3
Domain Number 1 Region: 9-275
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.16e-75
Family Protein kinases, catalytic subunit 0.00000000963
Further Details:      
 
Domain Number 2 Region: 507-569
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000107
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0066
Further Details:      
 
Domain Number 3 Region: 578-639
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000445
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1I4WWK3
Sequence length 676
Comment (tr|A0A1I4WWK3|A0A1I4WWK3_9PSEU) Serine/threonine protein kinase {ECO:0000313|EMBL:SFN17867.1} KW=Complete proteome; Reference proteome OX=260086 OS=Pseudonocardia ammonioxydans. GN=SAMN05216207_1009144 OC=Pseudonocardia.
Sequence
MTTPRLLSERYELGDPLGYGGMSEVHRGLDTRLGRDVAVKVLRADLARDPQFQLRFRREA
QNSASLNHPAIVAVYDTGEVESEFGPLPYIVMEFVDGQTLREIVKTQGPLSQQRVVEVMA
DVCAALDFSHRHGIIHRDVKPANVMINGVGAVKVMDFGIARALGEGQNVTQTAAVIGTAQ
YLSPEQARGESVDARSDVYAGGCVLFELLTGEPPFTGDTPVAVAYQHVREDPRAPSELNP
SVPPALDAVVLKALSKNPANRYQSAAEMRADLVRVRNGEPVHAPLVMSEYERTQMMAHDG
GSDATAAMATRRLEPGAGGPPTGRHTMPPGHPDYPDDERSGRGRKAALWVVALAVLGLLG
FVGFQMFSNSGPDRITVPDVLGQTPEEARAAITTAQLLVDLQNQPSDVGQVGKVVRTDPG
GGNQVAENSRVTVYVGTGPSEVTVPSLAGRTPQEAEALLRDAGLQLGGTNEQDTSDTSKI
GKVISSSPGPGESVAGNSAVSIVVGREQQTVPVPDVAGQSPEAAQSTLRGSGFTSVSVSE
VDGGGDAGKVVGTDPAAGTRVAKNQTITIQVSRGNRSQIPDVVGRRVDSAVNTLREAGLS
FRIETTDVSDPSRNGVVLSQSPSGGSQASDGQEVTLTVGQNSGDGGGGGNNGNGGGRDDN
SGGDSTDTTSQGFPFD
Download sequence
Identical sequences A0A1I4WWK3
WP_093341289.1.38704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]