SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1I5Y0H2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1I5Y0H2
Domain Number 1 Region: 4-297
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 3.41e-45
Family Glyoxalase II (hydroxyacylglutathione hydrolase) 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1I5Y0H2
Sequence length 317
Comment (tr|A0A1I5Y0H2|A0A1I5Y0H2_9BACI) Glyoxylase, beta-lactamase superfamily II {ECO:0000313|EMBL:SFQ37685.1} KW=Complete proteome OX=1761767 OS=Bacillus sp. ok634. GN=SAMN04487920_101768 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MTAIHRMEIPVPFAVETVNVFLVEGETLTLIDTGTNTEEAKKALESQLGALGYKIEDIET
VVITHHHADHCGLLNTFSEKVKIIGHPWNEPWITQNAEFLKRYHEFFKETALQFGVPAVF
LNGEALLTTKTLKYSCNRSLTHTVREGDRIDSLPGFTVIETPGHASTHISLYRESDGILI
GGDALISHISSNPILEPPYEGQTERAHPLLQYNQTLKRLSEMNISRILSGHGEDVLNVKQ
LIETRLQKQETRAFKVLELLKEKPMTAFEVCVKLFPVLYKEQLPLTISETVGQLDFLAYN
QQVMIDESSQQLIYYAK
Download sequence
Identical sequences A0A084J3B1 A0A150C337 A0A1I5Y0H2 A0A243A435 A9VG75 C2Q0I6 C2SPT5 J7WGI7 J8FIK1 J8IJ62 J8P095 J8P6F4 J8PV11 R8CZY1 R8ENI6 R8I3U0 R8MND7 W4DR99
WP_002014957.1.10033 WP_002014957.1.100646 WP_002014957.1.100649 WP_002014957.1.11324 WP_002014957.1.17940 WP_002014957.1.20051 WP_002014957.1.20881 WP_002014957.1.21695 WP_002014957.1.27729 WP_002014957.1.27732 WP_002014957.1.28299 WP_002014957.1.2902 WP_002014957.1.2904 WP_002014957.1.30061 WP_002014957.1.31050 WP_002014957.1.35095 WP_002014957.1.36226 WP_002014957.1.37635 WP_002014957.1.37801 WP_002014957.1.38645 WP_002014957.1.39317 WP_002014957.1.39896 WP_002014957.1.4354 WP_002014957.1.4496 WP_002014957.1.46157 WP_002014957.1.47674 WP_002014957.1.47957 WP_002014957.1.52845 WP_002014957.1.54007 WP_002014957.1.57105 WP_002014957.1.59016 WP_002014957.1.60236 WP_002014957.1.63476 WP_002014957.1.6426 WP_002014957.1.64566 WP_002014957.1.68186 WP_002014957.1.72867 WP_002014957.1.75292 WP_002014957.1.79293 WP_002014957.1.82832 WP_002014957.1.8290 WP_002014957.1.85187 WP_002014957.1.86789 WP_002014957.1.87416 WP_002014957.1.93582 WP_002014957.1.99558 WP_002014957.1.99908 315730.BcerKBAB4_3968 gi|163941879|ref|YP_001646763.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]