SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1L2C9F4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L2C9F4
Domain Number 1 Region: 77-160
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000157
Family Myosin rod fragments 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1L2C9F4
Sequence length 165
Comment (tr|A0A1L2C9F4|A0A1L2C9F4_9CAUD) Uncharacterized protein {ECO:0000313|EMBL:AMD43527.1} KW=Complete proteome OX=1622116 OS=Pseudomonas phage ZC08. GN=ZC08_029 OC=Viruses; dsDNA viruses, no RNA stage; Caudovirales; Podoviridae.
Sequence
MTNPFNQIRFRGEHELGRAYMDIKKALENLSDIKLVADNIKNLRSGNIELRSEGSVLQWK
YVNGTEWNDLVDLQILVEEYDEKFVQINQTLQNLNTQLNNFNGIVSGHSSTLSDLDQALQ
NLNTQLSDLSGIISTHEDTISLLESSVANLTSRVEALENNNGGEE
Download sequence
Identical sequences A0A1L2C9F4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]