SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1L7CQ69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L7CQ69
Domain Number 1 Region: 3-272
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-72
Family Protein kinases, catalytic subunit 0.0000000933
Further Details:      
 
Domain Number 2 Region: 388-449
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000458
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0093
Further Details:      
 
Domain Number 3 Region: 457-517
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000706
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1L7CQ69
Sequence length 665
Comment (tr|A0A1L7CQ69|A0A1L7CQ69_9CORY) Serine/threonine protein kinase {ECO:0000313|EMBL:APT87977.1} KW=Complete proteome; Reference proteome OX=1437875 OS=Corynebacterium frankenforstense DSM 45800. GN=CFRA_00170 OC=Corynebacterium.
Sequence
MTLIADRYELGDVIGTGGMSEVFAAEDTLLGRGVAVKMLRPEMARDLNFRERFRREAQNS
GRLNHPAIVAVYDTGEAEIDGLGVPYIVMERVFGRTLREILHADGPMRPAEAARILEPAC
RALTASHEAGIVHRDIKPANIMITNTGQVKVMDFGIARALDDSTSAMTQTSAVIGTAQYL
SPEQARGKPADGRSDLYALGCVFYELVTGRPPFQGETPFAVAYQHVQEDPVPPSHHIADL
TPTEAVNVDSVILTAIAKHPADRYQTADEMASELELLSRGAVTQAARSHVSPAAAGAGYA
DDDGRDVGNQTATTVMAAGGTHAAERPAPVAEGRPQRHDDRARHRRGASNWPRWIAAVLA
VVVLAISGAFAYDFFTNEDDSATSSSAVAVPDVVGWQRTDAEQALEKAGLRVDVNEEPSP
DVPRGQVIRTNPGAGSRLQPGTAVVLIVSSGREITDVPDLSGMSLDEARRTLENAGLSLK
GQVEEEESDSVPAGQIISQNPAAGSQISKGTEIAVTVSTGKKQVRVPDLKGLSLDEARST
LESMGLRVEPNYVDSREPEDRVLSVDATGSEVDEGSSVTVTVSNGRLIEMPSITRMTRAQ
AIAALREAGWQGPDSALTTGEPVATGALTDQDKIAVSTPAAGEDLRRDQAVEVRVWDFRP
EALLP
Download sequence
Identical sequences A0A1L7CQ69
WP_075662946.1.6914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]