SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1L7V2N2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L7V2N2
Domain Number 1 Region: 4-280
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.09e-86
Family Capz beta-1 subunit 0.0000000633
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1L7V2N2
Sequence length 282
Comment (tr|A0A1L7V2N2|A0A1L7V2N2_FUSPR) Probable F-actin capping protein beta subunit {ECO:0000313|EMBL:CZR35157.1} KW=Complete proteome OX=1227346 OS=Fusarium proliferatum (strain ET1) (Orchid endophyte fungus). GN=FPRO_00721 OC=Fusarium; Fusarium fujikuroi species complex.
Sequence
MAVDPFDSALDLLRRLNPKQTTDHLNAIISIAPDLTEDLLSSVDQPLTVRRCKQTGRDYL
LCDYNRDGDSYRSPWSNQFDPPLDEAGSGGVGAGGNEGAGEGAIPSERVRKMEVKANEAF
DVYRDLYYEGGVSSVYFWNLDDGFAGVVLLKKSSPQGGNSEGVWDSIHVFEAIERGRSTH
YKLTSTVILTLSTAGGNLGEMDLSGNMTRQVEQDLPVDNDDSHIANVGRLVEDMELKMRN
LLQEVYFGKAKDVVGDLRSIGSLSEGARDREAQRELIGSMRR
Download sequence
Identical sequences A0A0I9XWY2 A0A1L7S9W5 A0A1L7V2N2 A0A2K0VY27 N1RD95 S0DIM0 X0LPU5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]