SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1L8DW90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L8DW90
Domain Number 1 Region: 860-983
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.22e-37
Family Regulator of G-protein signaling, RGS 0.0000945
Further Details:      
 
Domain Number 2 Region: 1159-1244
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.24e-22
Family Ras-binding domain, RBD 0.0037
Further Details:      
 
Domain Number 3 Region: 21-109
Classification Level Classification E-value
Superfamily PDZ domain-like 2.4e-20
Family PDZ domain 0.0065
Further Details:      
 
Domain Number 4 Region: 1100-1168
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000792
Family Ras-binding domain, RBD 0.0095
Further Details:      
 
Domain Number 5 Region: 230-352
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000344
Family Phosphotyrosine-binding domain (PTB) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1L8DW90
Sequence length 1681
Comment (tr|A0A1L8DW90|A0A1L8DW90_9DIPT) Uncharacterized protein {ECO:0000313|EMBL:JAV10702.1} OX=330878 OS=Nyssomyia neivai. GN= OC=Psychodidae; Nyssomyia.
Sequence
LLSSSVVHCSISQGNWRKMHRRRKKRPNYGTRTVEVCRGINGFGFTISGQQPCILSCIVT
NSPADLAGLRAGDFLINVNGLNVSKLPHEAVVQLIGNSSGSIRMTIAENYFSDSSDEDPI
NTHTNVQRVRPKYQNKIKANRGLMRRTMDDRNSPSTILSDFALHNLALRQIRENETLMPL
SPKGHDIILSPTASDTKDVRNVSAMVRASNKAREEARTKALVPKMNRLREYRVIVGYLGT
VEVPRQIAMSGSKLQTVRGCIRKLRQEKRGFNTVLMTILPNCMTLKNCGDILLATFPAGT
INYVSSGSQSDNRFFGIITSGLYSDGLMCDPTEVILRHTTSHSCHIFAIDTRITDHSWHF
EKVNQFKITCSRDPLTNTCQEVPSTSEYVVNLIRSMYTLKSSGSRQEAPFRSKPPPGRGF
HMPRQHRLNPRALDDHDFMANSPQPSNHSEITTTSSNSDSGIGFHNDCPNLSDRVLVVDF
PGIKNHKLIPSFRPNPIGSSDTSLRSCGLSSAQQEVESLGHNSSIVESIEGKLKPQHSKS
KSADNTPRPSTSRDTDPRLTVRAMPDPKILNARDDSTGYETVFPALPLKYWPSGKAIDDD
GNIVQERPVDVPTTYGDTDRPFSCDITDLEQKRKSSFLHMARSCDDMILTFEKEFDRNVN
RPSIQFSMDDVSVREAKSPKVPQNDHIFLPPKPVKKPRKVHEGRKSSNMNKIMSYKLSPK
VFGLSRPMSASLENIARTFGKKPIDTKETSNIYGSLKDLNNIEFSTRQNLLDSNAYSEPD
LRSNEDARALPSNSGNSPFRRWGQSSFRSRSNEQRNLLPRRPSSLAASESDVYTKSINGD
IATGRNEGEFADATNGTCGVSGWSNSFERLLEDTAGLHAFAEFLKKEFSAENIYFWTACE
RYRQIEEQNERAKEAQEIFAKHLASTAQEPVNVDCQVRNTAEENLQSASVDLFEAAQKQI
FNLMKFDSYARFIRSDLFKSCLEAESKCKPLPYPGDQLDVGLRTGPIVPTPSKLKKSLSN
AEDRRRKSLLPWHRKTRCKSKDRDEANRHLSGGSKSGSSLRVPLMHSNSDLHSSRSSLSS
FDAAITKLNTNNDSEDGKSTLCRVILPDAATTIVQTRTGESVRELVDRLLEKRGLTYNCY
EAFLAGFSKPLDLDELSRNVAGKEIQIEQRVVFKLDLPNRKVISVKSKPCKYLEDVLRPI
LHKYNYRLEMVQVYGKESPDAIDMRIAVTAIDGQRLQIVIKATDGGSNVKQMSKLPTTAI
VDGNCDVAQLKNPVAQHPCMTGNFNQSTLDEITNKVFNELLQGKVETMAATSGATGPENP
LSRATVDQLSMKSEEWGSEASSGIFARARRHEFLHKHRMRKLPQSQKNSQTESEDNGDGT
KKPLIAKWKSGAKLQVTTRSSPGGDDLLEGLKRAQRSRLEDQRGTEINFELPEFLRNKEN
MSNSKNRRGYDDNEVDGRRDSSDRVSGFPPRPQPAPRLSIINNNNHANCGLSPRTPPPST
ALVGNNNEAASGGNYTNSAAIERSLLQLLETPPQQQRSDIEKFDSSSYLTPSRTGYTDPE
LFYGRHSGDRNAFRHGDLLNSSFSSTTTNNSTHYFEEMGGFGGEMDVQGARGPPPLPPKP
KVVPMKPSNWSQSTQRQKQSKMSPTSGIEDVFKIPMDMPRMSENTRKQKNAYFDQPSSSF
V
Download sequence
Identical sequences A0A1L8DW90

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]