SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1L9KPQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1L9KPQ8
Domain Number - Region: 148-225
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0232
Family Matrix metalloproteases, catalytic domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1L9KPQ8
Sequence length 331
Comment (tr|A0A1L9KPQ8|A0A1L9KPQ8_VIBFL) Metalloprotease LoiP {ECO:0000313|EMBL:OJI54478.1} KW=Complete proteome OX=676 OS=Vibrio fluvialis. GN=VFL11327_04102 OC=Vibrionaceae; Vibrio.
Sequence
MRIFGTAFPPRSSERCEAEIDTSQPHLLALHVNGEIFSADYHYLHISEPVGRLPVRISFP
NGWVFITEPSTALSKWLGFHKKQSFVDRMEGNIPAWILSAMVCLAVIAGCYYYLLPWGSQ
KIAESLPDSLSIAVGKQVLDSLDLQLEPSQLPEEQQSAIRQRVQQFAQVLPELPYDIKVE
FRSMPEGANAFALPGGTIVLLDELVALAQTQQQLDSIILHEMGHVHHRHMMKQVVHSTIL
SVAVSLITGESSGIVDNLAGVGVFIVSNGQSREAETQADLYAKKAMKQIYGTSEPLAEMF
ELFQTQEMMDIPEWFSSHPNFSERIQAAREE
Download sequence
Identical sequences A0A1L9KPQ8 Q7MHG0
196600.VV2911 gi|37681095|ref|NP_935704.1| WP_011151221.1.34622 WP_011151221.1.94371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]