SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1L9RJK1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L9RJK1
Domain Number 1 Region: 32-197,290-410,444-534
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.49e-59
Family Pyridoxal-dependent decarboxylase 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1L9RJK1
Sequence length 1134
Comment (tr|A0A1L9RJK1|A0A1L9RJK1_ASPWE) Uncharacterized protein {ECO:0000313|EMBL:OJJ35028.1} KW=Complete proteome; Reference proteome OX=1073089 OS=Aspergillus wentii DTO 134E9. GN=ASPWEDRAFT_68450 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MAVRAHANNGEDQITNQNVINNYFIGPRASNMPDFRANINTVLDELLETRLDYYPEDNNQ
KFITKEVRRSKEFQRVRDNFGDVVRKVAQLLGEHSVPFWSPRYEAHMCTDLTMPSLLGYF
MTMLYNPNNVALEASPMTTVAELLVGQQLCGLFGYRTPHTPDPKGKRKQEEPLSWGHITC
DGTVANLESIWVARNLKFYPLNLYLAIKYGKLKFIADKFEVETLTDGKKKFASLKTWDLL
NLKPKTVLDLPDLLFENYGISSDFLKDALEPYNIQSAGLMHKETDEENSTPETKEIDKFY
RSLKPMKFILSKTRHYSWPKGLAIAGLGSGNLLEVEVDDDAHIDLVQLEEKLEYCLDKKI
PVYAVVAIIGSTEEGAVDRLSKIIDLREKFQKRGLSFIVHADAAWGGYFATMLHRSRDGR
PEQGGADRGAVPALTLRKETEEDLIALQHADSITVDPHKAGYVPYPAGSLVYKDGRMRYL
VTWSSPYLSQGSSENIGVYGVEGSKPGAAAMSTWLSNQTIGLDPDGYGKLLGQASFTSSR
LSVRYAVHSNFKQGERKPFICVPLNRLPKEREGFAFNSDEVEGDRDEIRKKILGKDNEVL
MKHPDAMKLLRELGSDTNINAFSLNFYLKKEKDEKEENTKLNTDVEEANYLMKRVVDRLS
ITTANTDPTKIPVYLTSTKFEQELYGKCAKNFMKRLGLAEVDEDLFVLRNVVMSPFPTKH
YFIGKLWDEFEKVVNQEVRRVRTRNDPAAHKAQFLLQGTDKIFLVLQTSFHTATLRQQLI
VRADLDDELKQKYVKLKGDNPETSLLLVSRGKINLKEGIEKIESLPGKTFEFGAEIFKKA
DYLNNPEYYRHDPDLYLRNLNAYRHDPKQFLRNLDEYIQNTEEYLRHPEKYVHNPDDFSQ
VLEEQIEDVGEYLHNLKEYFAKLKDPKEPTKSLAQGKVKITRDGIIKSRPLNSINRDLKY
PQENMPFYLYGTPDHVHISHVLVRAPNIALSAANVKLSIFAGVEDRLSADDLSKGLILGL
TEKPEVAMQPFSGQVSATAESPDETFFFRSGKKFQVNIWRDKKASNAAGPGLLNDLGDPF
WSGTLTLGNDVDYDSEWPNKDPAATQKVDADRWQTELRSIGNVLNAGYVDPPAE
Download sequence
Identical sequences A0A1L9RJK1
jgi|Aspwe1|68450|estExt_fgenesh1_pg.C_4_t10374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]