SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1L9RZC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L9RZC7
Domain Number 1 Region: 29-467
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.1e-133
Family Pyridoxal-dependent decarboxylase 0.0000000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1L9RZC7
Sequence length 516
Comment (tr|A0A1L9RZC7|A0A1L9RZC7_ASPWE) Glutamate decarboxylase {ECO:0000256|RuleBase:RU361171} KW=Complete proteome; Reference proteome OX=1073089 OS=Aspergillus wentii DTO 134E9. GN=ASPWEDRAFT_22424 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MVHLARVKRDEEVNTSLPKRIDDIKLDMPDDGDDFCSTVYGSRFAGEHLPAHEMPDREMP
KEVAYRMIKDELSLDGNPMLNLASFVTTYMEEEVEKLMAESFSKNFIDYEEYPQSAEIQN
RCINMIARLFNAPTTGDDEHPMGTSTIGSSEAIMLGTLAMKKRWQNKRKAEGKDFSRPNI
VMNSAVQVCWEKAARYFDVEERYVYCTDQRFVIDPKEAVDLVDENTIGICAILGTTYTGE
YEDVKAMNDILVERNIDCPIHVDAASGGFVAPFINPNLLWDFRLEKVVSINVSGHKYGLV
YPGVGWVVWRSHDFLPKELIFNINYLGAEQASFTLNFSKGASQVIGQYYQMIRLGKRGYR
AIMVNITKIADYLASELEKLGFIILSQRGGHGLPLVAFRLPDSRQGHFDEFAIAHQLRER
GWIVPAYTMAPHSNELKLMRVVVREDFTMNRCDTLITDIKLALKTLEEMDQAMLHKYTVH
MKANATNSAKAKHNHHHYKNEKHSLQGKTGKTHGIC
Download sequence
Identical sequences A0A1L9RZC7
jgi|Aspwe1|22424|fgenesh1_pg.1_#_230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]