SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1L9SSF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L9SSF9
Domain Number 1 Region: 52-407,435-517
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.49e-120
Family Pyridoxal-dependent decarboxylase 0.000000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1L9SSF9
Sequence length 562
Comment (tr|A0A1L9SSF9|A0A1L9SSF9_9EURO) Glutamate decarboxylase {ECO:0000256|RuleBase:RU361171} KW=Complete proteome; Reference proteome OX=1073090 OS=Penicilliopsis zonata CBS 506.65. GN=ASPZODRAFT_128759 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicilliopsis.
Sequence
MALAKHIDADELVAKLHDAPHTQRGKHVHAARAARVAAAGSGGGGSQGDNDIHPYASRYA
SQQALTKHRIPKDGAPADAVHQMLKDELDLDGRPNLNLASFVGTYMEREAEQLIIENLSK
NMSDCDEYPAMMDMHARCVSIIAHLWGAQKGETPIGTATTGSSEAIHLGGLAMKRRWQEK
RMAEGKDTTKPNILMGANAQVALEKFARYFEVEARILPVSEGSRYRLDPALVREQLDENT
IGVFVILGSTYTGHYEPVEEISRILDDFEAETGVDVPIHVDGASGGFIAPFTYAGAGFKW
NFELPRVKSINVSGHKFGLVYAGVGWIIWRDESQLPKHLVFELHYLGGTEESYTLNFSRP
GAQVIGQYFMLEHLGFNGYRAVMENALANARLLSRALEATGWYRCVSDIHRKKGDFAYDA
TKVDTPFLASERSDAYNAGLPVVAFTLTDDFHAKHPNIKQAAISNLLRAKQYIIPNYPLP
PNEEKTEILRVVVRESHNLDLIDRLIADICSVTQALIDNEVPDLSAWQPFSHSVEKEHQS
LGQKDPRKAKRPMSEGIHRGVC
Download sequence
Identical sequences A0A1L9SSF9
jgi|Aspzo1|128759|fgenesh1_kg.2_#_796_#_Locus1718v1rpkm122.70

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]