SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1L9SU25 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L9SU25
Domain Number 1 Region: 117-480
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.96e-88
Family Glutamine synthetase catalytic domain 0.0000572
Further Details:      
 
Domain Number 2 Region: 22-100
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.00000301
Family Glutamine synthetase, N-terminal domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1L9SU25
Sequence length 482
Comment (tr|A0A1L9SU25|A0A1L9SU25_9EURO) Uncharacterized protein {ECO:0000313|EMBL:OJJ50624.1} KW=Complete proteome; Reference proteome OX=1073090 OS=Penicilliopsis zonata CBS 506.65. GN=ASPZODRAFT_148100 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicilliopsis.
Sequence
MDSSSAVTLESLPSLLAEDIKVKVAGVDSDGILRGKVMSKEKFLSVMEKGFGFSSAVFGW
DMHDMLYTTDARIAPPESGYSDFIAIPDLTSFRRIPWEEDIPFFLLRFVNNKKPVPADGR
NMLKSVTDRLAESGYQALAGVELEFMNFQTPSENGYDIQGSKHLDIATYLEKNTPGSLRP
LTAGMFSYSATRPVANKGYFYDIFNISSQFKCNIEGWHTEGGPGVYEAALKVCNVNEMAD
RVSLFKFLTKSLGMEYGITPCFMAKPIQGQAGNSGHIHISLCDLEGQNVFARDEEDPNAP
WPDLAGVSEIGRHFLAGLLEALPDIMPLFAPTINSYKRLVENYWAPVYISWGLEDRMASI
RLIAPPVCKPGATRFEVRIPGADLHPHYALGALLAAGWRGVQKKLEITVPPLSVLQSKGV
RPELLPDSLHHAVQRFKAPNSIARQVLDPEFVDFFAATREHELKVWREAVTDWEFKRYIE
TV
Download sequence
Identical sequences A0A1L9SU25
jgi|Aspzo1|148100|fgenesh1_pm.1_#_151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]