SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1L9TNG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L9TNG6
Domain Number 1 Region: 120-448
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 8.63e-67
Family Glutamine synthetase catalytic domain 0.00022
Further Details:      
 
Weak hits

Sequence:  A0A1L9TNG6
Domain Number - Region: 13-108
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.0248
Family Glutamine synthetase, N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1L9TNG6
Sequence length 450
Comment (tr|A0A1L9TNG6|A0A1L9TNG6_9EURO) Uncharacterized protein {ECO:0000313|EMBL:OJJ60955.1} KW=Complete proteome; Reference proteome OX=1036612 OS=Aspergillus sydowii CBS 593.65. GN=ASPSYDRAFT_87523 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MDNQASLAQLDANAQEVDFVWVLFTTYIGTNLVRIVPMPAFKRLLETNQGISVPKTVLHI
LPHDNVADGGTSVGSFFLQPDPRSLVSPYLDPNKAIVMSTWADKENKPMGECARYKLDTL
TRSIEQKAKCSVLVGFELEFCILRQTILPGGQVEYEPVNVDHAWCTMSMTREAELLLGVL
EEVVLALQDLGIMVQQFHAELGPDQWEFILPPDSPLKAVDALVLARQVVMKIASKHGYRA
TLHPRLSAEKPGTGAHVHISLNSPELNSSSDQVDLSTVESFFAGILDNFPSVSAFTLPQE
ISYERVLGGIASGGEYVSWGWENKETILRRICNNRFEVKMMDGLANPYLALCALLAAGLD
GLLQGSPLRAGPCPVEPAKMSDQERAALGIEAKVPTGLAESLENLETNERLRLALGDSLV
STYLAVKRGELKVVQRKTPEEQRAWFISRY
Download sequence
Identical sequences A0A1L9TNG6
jgi|Aspsy1|87523|gm1.4206_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]