SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1L9VBH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1L9VBH4
Domain Number 1 Region: 138-442
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 9.61e-48
Family Glutamine synthetase catalytic domain 0.0014
Further Details:      
 
Weak hits

Sequence:  A0A1L9VBH4
Domain Number - Region: 32-61
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.0249
Family Glutamine synthetase, N-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1L9VBH4
Sequence length 450
Comment (tr|A0A1L9VBH4|A0A1L9VBH4_ASPGL) Uncharacterized protein {ECO:0000313|EMBL:OJJ81250.1} KW=Complete proteome; Reference proteome OX=1160497 OS=Aspergillus glaucus CBS 516.65. GN=ASPGLDRAFT_50784 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Aspergillus.
Sequence
MKLPQTHPHSPIPSEKTTPLNHNETAIRNLQLKNPSLRFIRFQWQDYSGALRGRILPIHH
CLRLAKENKPIEVPPTAFECIFDNMPLPDLNPTGTDSLLPDWGSARTSSQSVVSEESYAT
VMCEVMRSKPASPVSELDLCPRRALAKVVHKAIEVCGLSFLVGFEVEFGVMKVSADWSDI
IPHSTGSGRFAIGQRDPCFAHVEECICELQYAGIDIESFQTQGRHQYQLSLHPRPPLQAV
DELILVHDRIKRVFAKHGYIATMCPKPVASRQQTTSQHMHISISPPYAESSFLAGILKRL
QALCAFSLPYDLCYEREQPYPNSEVVAWGTQNWEVPIRKIKPGHWDFRCVDATANMYLTL
AAFLGVGILGIQNEEPLVWPDTGIPGRLDPAAYLPSSLEDALCFLEVEADEIEEIMESKI
VDRYIELKRVESSRMRKNLGEARRLHIEVF
Download sequence
Identical sequences A0A1L9VBH4
jgi|Aspgl1|50784|fgenesh1_kg.20_#_233_#_Locus6114v1rpkm12.55

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]