SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1M4V5Y2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1M4V5Y2
Domain Number 1 Region: 8-275
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.78e-79
Family Protein kinases, catalytic subunit 0.00000000645
Further Details:      
 
Domain Number 2 Region: 508-568
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000017
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.011
Further Details:      
 
Domain Number 3 Region: 573-637
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000183
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1M4V5Y2
Sequence length 664
Comment (tr|A0A1M4V5Y2|A0A1M4V5Y2_STRHI) Serine/threonine protein kinase {ECO:0000313|EMBL:SHE64396.1} KW=Complete proteome; Reference proteome OX=2017 OS=Streptoalloteichus hindustanus. GN=SAMN05444320_101653 OC=Streptoalloteichus.
Sequence
MTTPRLLSNRYELGDTLGYGGMSEVHRGRDVRLGRDVAVKVLRADLARDPQFQLRFRREA
QNAAALNHPAIVAVYDTGETETEYGPLPYIVMEFVDGRTLRDMIKSEGPLPPRRAMEIMA
DVCAALDFSHRHGIVHRDVKPANIMITRSGAVKVMDFGIARALADGQAAVTQTAAVIGTA
QYLSPEQARGETVDARSDVYATGCVLFELLTGEPPFTGDSPVAVAYQHVREDPRTPSDVN
PQVPTVLDAVVLKAMSKNPANRYQSAAEMRADLVRVLSGQRPSAPAVMSEEERTTMLGGG
GGATEVMGGRHRPNALADSAADQADEQAARRRKTTMVALVTALCVAVLAIAAWVTTSLLG
NNEAPKQEKIALPNVVNVELVQARNQLTAKGFTNVQEKTAPSSAEQRGMVTSMNPPAETQ
VGKNDPIVLTVGSGPERTKVPDLSGKTQEQARQLLADQGLQLALDVDQEETDNSALVGKV
VKQSPAVGAEVDKNSRVSITVGKALDQVQVPPLTDMTLDNARSVLDSLGLTASTSNVASD
KDAGTVVGQSPAKGTRVKKGTSVTLQVSDGSQKNKIQMPKLDGMTPDQAKQKLNQLGWNG
SLDATETPTDKQSEDGKILNQSPNPGEKIDPNQRIRVAVGKYKSGGHNGTTTTTTPPGGG
FLGR
Download sequence
Identical sequences A0A1M4V5Y2
WP_073479776.1.83283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]