SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1N7FKT2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1N7FKT2
Domain Number 1 Region: 539-948
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.04e-35
Family alpha-mannosidase, C-terminal domain 0.016
Further Details:      
 
Domain Number 2 Region: 129-311
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.00000000000000252
Family alpha-mannosidase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1N7FKT2
Sequence length 971
Comment (tr|A0A1N7FKT2|A0A1N7FKT2_9SPHI) Glycosyl hydrolases family 38 C-terminal domain-containing protein {ECO:0000313|EMBL:SIS01018.1} KW=Complete proteome; Reference proteome OX=354630 OS=Mucilaginibacter lappiensis. GN=SAMN05421821_11879 OC=Sphingobacteriaceae; Mucilaginibacter.
Sequence
MKIRQSRIKSFCLITILFLLSTVATGVYGQKAQPAFTSITLQPTVAYVNYHGENRRVARL
LFKSGKSYNAGTLSVSFNNHTDNIAIPTSATGLDVFEVPLPGPAIKIATQLTVTLTYNGQ
TYWARCIVEPARDNWTVYVLPHSHVDIGYTNTQAKVLKLHMDNIDESIDLAEKTQNYPAE
ARFKWTTEAIWVVDNYLKQASAEKKARFWSAVKKGWISLDGAYGNINTSMTDSRQLMQMF
AKSQKLAREQGIEIHTMFQGDVPGASWGLAAQAEQTGIHYFLSGPNASDRIGNLAKWQDK
PFYWLSPSGKQKLLFWQCQPYSIGYQLKGAKIPNFFTIDDPKPYYTGHPEENFLNPYLFQ
YLGNLEQNNFPYNMTILTWAMSDNAPIDPELPDAVKAWNEHYTSPKLIITSVKQFFNDLE
KQYKNEIPSFSGDYTEYWTDGVSSAARETALSRITSDRLKQTGAIWAIRNKPAYPVVAFD
DTWKNLLLYHEHTWGAYNSVGEPDNEKVKSEWNVKQGYVLRAEKQVDSLMTEALKPSATQ
THAIDVYNTTNWLRTDVVYIPASLSKTGDLVKDATGKKITSQRLSSGELAFVANAVPALG
KSTYTIYTGKAFSNGQARVSGNSLSNDIYTVAVDAKSGNIVKLIKGATSRNYVAADSAGL
NQYMYMPGDSLKKLVSTTNTQINIKEKGPLVVSLLITSDAPGTQGLTREVRLVSGLDQVE
IINTIDKTAIRNKESVHFAFPFNVPGAQVRYSIPWGSALAEADQLPYANHNWFTMQRWVD
VSNSAYGITWSSPDAPLFEIGSITTGNLLGGLHHAPQWLSFTPQSPVLYSWVMNNLWHTN
FRADQEGKATFHYFIQAHEIGFNNFKANQKGLNNHQPLVVSAATGAPEKGLFLKINGDNI
YVEALKPTDDGQGVIAQLVNSGDTDSEVDITPNTVSTIKVWESNLMEDKLKPLNDRFTIP
AKGVLSVRIER
Download sequence
Identical sequences A0A1N7FKT2
WP_076377735.1.95830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]