SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1Q3FV22 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q3FV22
Domain Number 1 Region: 884-1007
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.83e-35
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1203-1294
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.11e-25
Family Ras-binding domain, RBD 0.0038
Further Details:      
 
Domain Number 3 Region: 23-108
Classification Level Classification E-value
Superfamily PDZ domain-like 2e-18
Family PDZ domain 0.0076
Further Details:      
 
Domain Number 4 Region: 218-350
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000287
Family Phosphotyrosine-binding domain (PTB) 0.017
Further Details:      
 
Domain Number 5 Region: 1147-1215
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000661
Family Ras-binding domain, RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Q3FV22
Sequence length 1866
Comment (tr|A0A1Q3FV22|A0A1Q3FV22_CULTA) Putative regulator of g-protein signaling {ECO:0000313|EMBL:JAV31302.1} OX=7177 OS=Culex tarsalis (Encephalitis mosquito). GN= OC=Culicidae; Culicinae; Culicini; Culex; Culex.
Sequence
NGYEFPLISVNLWVKMHGHRRRKKRPNYGLRTVEVNRGLHGFGFTISGQQPCILSCIVGN
SPADLAGLRAGDFLISVNGLNVSKLPHEAVVQLIGSTYGAIKMAIAENYYSDSSDEDGLF
QGSTQHRVRPKYLNHKTKFQQRMTSAKQHTSMNGPADLVGTCEAATAIVVNDSPTAYNVI
HSPNASNSCDISNVSAMVRSVQLEDEEAGPSQQPDREIALEYKAIVGYLGTIEMPKQIAT
SSKLQTVRSCIRKMRQEKRNPTTVLMTILPSCLNLINTSNAVIAKYSSVRLSYVSSSSES
DNRYFGLVTSAIYADGLMCESAEILNQRKDVVISNSCHVFVIDARMVDHAAHLEKADLFQ
LVCTKDPITNLCLEFPSNSEYVVNLIRSMYNLKAPPLKPSDSYGKPPVARSLNLDRRANP
REDPHDLLASNSPQPSNHSEITTTSSNSDSGIGFHNDCRNISDRILVVDFPGGNHQINNV
RAHFRKSVPFGRPVGIINELPQPLDPIRNIRSTTSSTGPQIFHGKSKSADYGYQPSGLDR
LTVRARPDPKLFPPDRSPSKDNALNHDYALFPAADLPQQTVDDAGNVVQERPVDIPAQLA
HSPTFLDLQRYNADNVKNSLLARSCDDMIMTLEKEEPEPPPPKAVDDQHVFLQPAKPIKR
AKKACSHRPGSRQPADDGSSKLLSYKLSPKVFGLARPLAASFENIPTGDEVGEKTRKMDA
SAEVQPERSRAAKRLSGGFSAIWGSLQELRSGGGGSKQTEVEPGERVVMKKLQLQQERRP
VLPGAFSEPDLRCDENKQINHNASPFRRWGQSSLRSRSGEQRTPSSSHRRPSSLAASESD
VYTKSIDDDYSSTKSGYNPYVDAASALTTTESTQTSTTVSSGPAGVASWGTSFEKLLEDP
AGLHTFSEFLKKEFSAENIYFWTACERYRQLVDREERAKEAQAIFAKHLESGCSEPVNVD
SIARNIAQENLPQAEQTLFGAASKQIFNLMKFDSYQRFIKSDMYRTCQEAEAKGHPLPYP
GDQLDPLLRTSFAVQTAATKLKKSLSNAEDRRRKSLLPWHRKTRCKSKDRGDSELKKESG
GGNKATLSAGGGGSGGGGGNGTGGSSNTLKVLSTNSTSDIHSSRSSLASFDAAIGKSYDQ
EDQTRNTLCRVILSNGATTVVQTRSNETIKELVERLLEKRGIVYTAYEAFLAGNHKPLDL
DGPSSSLAGREVNIDQRVVFKLSLPNRKMISVKSKATKPLGDVLRPILLKYNYELDQMNV
YSKEAYLDMTYPVTSVDGLWLQVRNGNENEFHQDLTRTIASRSERAYANQVPPLPIIATS
QHAQIINHFQQQLQHSQHNGFLNNNNNNNVTKKSQLAYAGQIHNNNNNNHAKGKDEQSAK
EDAAVGGKQELNMLDEITNKVFNELMNGKIANGPKVPPEDCTSDSSSTRRGDRFRRRGSN
APSESGRGAKSKKCSTAGSEDGGESVGNAATGMKKPIIAKLKAGVKLQIPTRSQNDELLE
GLKRAQRSRLEDQRGTEINFELPDFLKDKENFTSTTTAGSSSAATGSGANSAAMAAPSSK
FTRKFGKRPESAEFPLSASTNGGSLQQIHKPQPAPRLSISRGGGATAPGANPSSPVQSAS
SESNLNNLSLRCNASPLTLDDNGNGSQSENSYAEATMIFTHASANAQHSPESSPPSSHRY
HHLDSGSAAAAASDHHHYEAIDGGSSAADLVDGGVIYHPPYHRHPHHHHQQHNHNSKQHH
LSASTSSGSSTGSSTSSSGSSTSSNSSDADNQKGPPPLPPKPKILPIKPSNWGHSTGGGS
GMSASMSNLPAATGGASSQNGVCGSNNSVSVSSNNKEKRLSGTEQKQGQQQQTRSVYLDH
ASSSFV
Download sequence
Identical sequences A0A1Q3FV22

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]