SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1Q4YGB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q4YGB2
Domain Number 1 Region: 7-273
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.32e-77
Family Protein kinases, catalytic subunit 0.000000036
Further Details:      
 
Domain Number 2 Region: 523-585
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000222
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0063
Further Details:      
 
Domain Number 3 Region: 460-518
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000903
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Q4YGB2
Sequence length 675
Comment (tr|A0A1Q4YGB2|A0A1Q4YGB2_9ACTN) Serine/threonine protein kinase {ECO:0000313|EMBL:OKI33633.1} KW=Complete proteome OX=1718987 OS=Streptomyces sp. CB03578. GN=A6A28_06830 OC=Streptomyces.
Sequence
MEEPRRLGGRYELSHVLGRGGMAEVYLGHDTRLGRTVAVKTLRADLARDPSFQARFRREA
QSAASLNHPAIVAVYDTGEDYVDNISIPYIVMEYVDGSTLRELLHSGRKLLPERTLEMTT
GILQALEYSHRAGIVHRDIKPANVMLTRTGQVKVMDFGIARAMGDSGMTMTQTAAVIGTA
QYLSPEQAKGEQVDARSDLYSAGCLLYELLSVRPPFIGDSPVAVAYQHVREEPQPPSNFD
PEITPEMDAIVLKALVKDPDYRYQSADEMRADIEACLDGQPVAATASMGAAGYGYPDQGG
YGHQGYDQPTTALRATDSGGQTSMLPPMPPGDNGYGYGDQGGHGGYDQGHGRRPKKSRAS
TILLVLAGVLVLVGAILIGRAVFNGGADNRPNVPKLIGETLEAAQGNANNVGLKVVKEAE
EPCDSQPKGKICSQNPQPDTKLDKGEAIKVKISSGAPKVPVLDVINLTFDNAEKTLKDKG
FQVERKTQESERTAGTVLDQNPKAGTEAEKNSVITLIVAKEVSKTEVPDLTGKTKEEAAK
LLQQANLKLGSTTESDAPAGTAPKTVFQQQFPPGEQLKPGSSVSITVAKAAQTTDVPNLA
GKTVSQARGILAGKGLTFGAVVAGPGDENAKVIISDPPAGTQVPPGTVVNVTTIAGGGGQ
QDGGNGFFGGLTGRR
Download sequence
Identical sequences A0A1Q4YGB2
WP_073797769.1.85852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]