SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1Q5Y671 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q5Y671
Domain Number 1 Region: 60-329
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.25e-88
Family L-arabinose binding protein-like 0.00000131
Further Details:      
 
Domain Number 2 Region: 1-59
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 9.48e-18
Family GalR/LacI-like bacterial regulator 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Q5Y671
Sequence length 332
Comment (tr|A0A1Q5Y671|A0A1Q5Y671_HAEIF) Transcriptional repressor PurR {ECO:0000313|EMBL:OKQ04690.1} KW=Complete proteome OX=727 OS=Haemophilus influenzae. GN=BLA59_00210 OC=Pasteurellaceae; Haemophilus.
Sequence
MATMKDIARLAQVSTSTVSHVINGSRFVSDEIREKVMRIVAELNYTPSAVARSLKVRETK
TIGLLVTATNNPFFAEVMAGVEQYCQKNQYNLIIATTGGDAKRLQQNLQTLMHKQVDGLL
LMCGDSRFQADIELAISLPLVVMDWWFTELNADKILENSALGGYLATKALIDAGHRKIGI
ITGNLKKSVAQNRLQGYKNALSEAKIALNPHWIVESHFDFEGGVLGIQSLLTQSSRPTAV
FCCSDTIAVGAYQAIQQQGLRIPQDLSIMGYDDIELARYLSPPLSTICQPKAELGKLAVE
TLLQRIKNPNENYRTLVLEPTCVLRESIYSFK
Download sequence
Identical sequences A0A0E1WKW0 A0A1Q5Y671 A5UH13 E7A726 F2BZ17
gi|148827699|ref|YP_001292452.1| WP_005686992.1.1036 WP_005686992.1.12713 WP_005686992.1.26667 WP_005686992.1.32414 WP_005686992.1.3733 WP_005686992.1.42821 WP_005686992.1.45125 WP_005686992.1.63263 WP_005686992.1.68713 WP_005686992.1.76410 WP_005686992.1.76422 WP_005686992.1.79564 WP_005686992.1.80605 WP_005686992.1.81823 WP_005686992.1.8638 WP_005686992.1.87366 WP_005686992.1.91647 WP_005686992.1.93908 WP_005686992.1.94547 WP_005686992.1.9601 WP_005686992.1.98200 374930.CGSHiEE_00460 374931.CGSHiGG_05790 gi|319897978|ref|YP_004136175.1| gi|148825216|ref|YP_001289969.1| gi|386265105|ref|YP_005828597.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]