SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1Q6FQ47 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q6FQ47
Domain Number 1 Region: 1-179
Classification Level Classification E-value
Superfamily Flavoproteins 1.27e-34
Family Hypothetical protein YwqN 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1Q6FQ47
Sequence length 179
Comment (tr|A0A1Q6FQ47|A0A1Q6FQ47_9BACT) NADPH-dependent FMN reductase {ECO:0000313|EMBL:OKZ00982.1} KW=Complete proteome OX=1896970 OS=Alistipes sp. 58_9_plus. GN=BHV65_06485 OC=Alistipes.
Sequence
MAKKVLILSSSPRRGGNSDLLCDRFMAGAQQAGHDVEKIFLRDKKINYCTGCGVCYGGAK
PCPQRDDAAEVVGKMIGAEVIVMATPVYFYTLCAQMKTLIDRTCARYTEMGGKEFYFILT
AAEESVEMMERTVECFRGFLDCLDDPEERGVVYGVGAWQAGEIEGMPAMDEVYELGRRV
Download sequence
Identical sequences A0A1Q6FQ47 E4MCW7 I3YR45 R5V0A6
WP_009598263.1.56960 WP_009598263.1.9852 gi|390948388|ref|YP_006412148.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]