SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1Q6JUG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q6JUG2
Domain Number 1 Region: 9-271
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-84
Family Protein kinases, catalytic subunit 0.00000159
Further Details:      
 
Domain Number 2 Region: 424-484
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000654
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0044
Further Details:      
 
Domain Number 3 Region: 493-554
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000275
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1Q6JUG2
Sequence length 668
Comment (tr|A0A1Q6JUG2|A0A1Q6JUG2_9CLOT) Uncharacterized protein {ECO:0000313|EMBL:OKZ56681.1} KW=Complete proteome OX=1896977 OS=Clostridium sp. 26_21. GN=BHV99_05050 OC=Clostridium.
Sequence
MDLKGRLLANRYEILEKIGSGGMATVYKAKCHVLNRYVAIKILRDEFTTDEEFVKRFEVE
AQSAASITHPNIVSVYDVGVDGNLHYIVMELVKGKTLKDIIVEEKGPLPWKWSVNIAIQI
ASALETAHKNHIIHRDIKPHNIIITEDGVAKVTDFGIAKAVSNSTITAFGTTIGSVHYFS
PEHARGGFTDEKSDIYSLGVVMYEMLTGRVPFDADTPVSVALKHMQEEPIAAIVANPNIP
IAVNDIIMKSLKKDPNLRYQSATAMLIDLKRALKEPQGNFVDNSEYVDAPTQRISTIQDD
NRGPKATAKKKENKFVAFVKKHKVLSTIVGLILLFVLSLGTTLGIANATRTKDVAIPNLV
GKTVDEAKKLVQDSKLVYSEGEAEYSADVEAGKIISQTPKYTQNGTVKEKSEIKVIVSLG
TEKTKVPKFVGTTKEEAEKSAKDAKLKLEFVEETSKTIEAGYITKQETDEGTEVNAGDTV
KLYISIGTGIKQVVVTSLYGVDAETAKKNLEEKGLVVEIEYTEDKTKDNGVVLNQSIKSG
ETVDEGSTITLTVNKIAETKTGTVTINVKSITGYQDKIKKPVTESVKGETTSTTIQKEVE
VDNTPNTIQLKVTVDGETVTDEKVKENVTDKQVSVSGKGNVTIKVYIDGILKKTVDMNLN
NTDKLTIE
Download sequence
Identical sequences A0A1Q6JUG2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]