SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1Q6K2I7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1Q6K2I7
Domain Number 1 Region: 4-267
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-82
Family Protein kinases, catalytic subunit 0.00000127
Further Details:      
 
Domain Number 2 Region: 430-490
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000615
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0052
Further Details:      
 
Domain Number 3 Region: 499-560
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000113
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1Q6K2I7
Sequence length 661
Comment (tr|A0A1Q6K2I7|A0A1Q6K2I7_9CLOT) Uncharacterized protein {ECO:0000313|EMBL:OKZ59535.1} KW=Complete proteome OX=1896989 OS=Clostridium sp. CAG:354_28_25. GN=BHV96_06555 OC=Clostridium.
Sequence
MDLEGKILGNRYEIIEKIGNGGMATVYKSKDRVLNRYVAVKILRDEFTTDEEFIKRFRIE
AQSAASLTHPNIVSIFDVGNEGSLYYIVMELIKGKTLKEIITEENGPLPWKWSLNVVTQI
ASALETAHKNNIVHRDIKPHNIIITEDGIAKVTDFGIAKAVSNSTITAFGTTIGSVHYFS
PEHARGGYTDAKSDLYSLGVVMYEMLTGRVPFDADTPVSVALKHMQEDPIEPKELNDNIP
QVVNDIIMKAMQKDVNLRYQSATEMLKDLNAALKNPDDNFVHIGSNIGAATQRISTQEIA
EAERKAKEANNPNNGKKPNKFIEFVKKHKALSFVIGAIILFFVAFGATMGIVELVNPNDV
QIPDLVNKTQDEAEQIVKDLKLKLVVKSEEYNENVEEGKIISQDPTYQENYTIKEHSEIS
VVISKGTETVEVPDVVGKTREEAEKLLKDAGLVAEITEENDEKVEAGIVLSQDIEDGETV
NKGSTVKLVVSKGSAIVNVEVPSLVGKTEQEARNLLTEAGLKVNVVNDEDESKNDGVVLR
QSKDAGTEVQEGTTITITVNKVSEAKEATFTIDVEAITGGYEEETGNSTSGNTAKTVDIT
ITVGGSEAFQQSNVDKKTTITARVSGKGSKEVVVTLTNSRGESYRRSTTFNFNNATTYTF
N
Download sequence
Identical sequences A0A1Q6K2I7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]