SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1S0UIL2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S0UIL2
Domain Number 1 Region: 347-522
Classification Level Classification E-value
Superfamily Fibronectin type III 1.83e-18
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 2 Region: 82-179
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000044
Family Fibronectin type III 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S0UIL2
Sequence length 932
Comment (tr|A0A1S0UIL2|A0A1S0UIL2_LOALO) Uncharacterized protein {ECO:0000313|EMBL:EJD75373.1} OX=7209 OS=Loa loa (Eye worm) (Filaria loa). GN=LOAG_17465 OC=Spiruromorpha; Filarioidea; Onchocercidae; Loa.
Sequence
MSDASIGCYLVRFYCHSLRLRFLLTAAYSGSANNVPLRNARCTPDNWCVAKCCLSNYIFF
PRRNYTFQMSLFKTDAVGKITPLSEHVTALSWDGVSQKALELTLSRSSEDTLEISWEHPS
IDITNGFLQKYVIEYYKDSESLREVKRKDILPNSTICLLNGIKSEVVYRFRVIPVTRHGL
PSDVYLKSNPNFTSIGHMVESTNKNFRSVIGSLPIDIEQMGTSIIIHWEVRETSNFTSQD
PKNQAVLIRYAPSDLSPLREKAEEGLFINGAMNLTEKFDASRTYQFCSRLYDGLFYGPDF
CRTYRLPPATFADIFSSFSSGNGLPRAVLCHHRKECRCEPSYEFGDAMRVTWDWPIDDHS
ADEFVVHYTLSDSFFPEDDRLVITDEAFADLPSLRSNTTYRIMIEPRNKMGGVEGSWFNC
TTPILGQIPAPTGVMYEELNATAVRVSWNPIHPNPRWSTPVGYVIQVQSSSTSMAPVKDI
LVDGISATSHVITLQPNMLYTFQVAARSNAGDLGQRSSPYLFAPSQISKPGRIDVRRPKM
FPKSSREGILIGIVLVVGLLTLCFGGICAHLRLKRRKLEMGINANAANRGTNGSRNITNY
EMESLITRRRSELIDAPGRNIPRDSLMHNQLNPQNSISNEVEVICLDTKGGEQGALPSGQ
DKYLRLLNDKKQLQRFKECFLFNGLSEESSVKSHISCRKKTKNVNRRNEPFTIMAKRSNY
KLLDSKWIRAACDTSDPWTGSLPSKKRVVRLGSTSTRTVKTCYLMTGRMSISNFDIMMPR
FLSKLTALSDNTRRNAASHVESLNQAISYTSIICPRSASVQSLYQRNGFIKQKNDSVKTS
VAITTNNYMNYPCNTPSSQSLTWYDAGSIENDGIMRLPRDTPKLHGNSNKGATMLCCSMP
NLTDSGIVYDEMHFPRPPPLSPPPLDNKHLEK
Download sequence
Identical sequences A0A1S0UIL2
LOAG_17465T0 XP_020306243.1.37734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]