SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1S3FB66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3FB66
Domain Number 1 Region: 17-340
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.13e-117
Family Aldose 1-epimerase (mutarotase) 0.0000000000371
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S3FB66
Sequence length 342
Comment (tr|A0A1S3FB66|A0A1S3FB66_DIPOR) Galactose mutarotase {ECO:0000256|PIRNR:PIRNR005096} KW=Complete proteome; Reference proteome OX=10020 OS=Dipodomys ordii (Ord's kangaroo rat). GN=Galm OC=Heteromyidae; Dipodomyinae; Dipodomys.
Sequence
MVSVTRTAFGELPSGAGPVEKFRLQSDLLKVDLISWGCTITALEVPDRQGKASDVVLGFA
ELAGYLQKQPYFGAVVGRVANRIAKGAFTLDGKEYRLAINREPNSLHGGLRGFDKVLWTP
QVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELVINYRAQTSHTTPVNLTNHSYFN
LAGQGSPNIYDHEVTIEADAFLPVDETLIPTGNVAPVQGTAFDLRKPVELGKHLQKFGIN
GFDHNFCLKGSKEKHFCARVQHPGSGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPK
HSGFCLETQSWPDAVNQPHFPPVLLRPGEEYNHTTWFKFSVA
Download sequence
Identical sequences A0A1S3FB66
ENSDORP00000008085 ENSDORP00000008085 XP_012873490.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]