SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1S3FKZ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3FKZ1
Domain Number 1 Region: 880-1014,1074-1140
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.21e-40
Family Hemopexin-like domain 0.00062
Further Details:      
 
Domain Number 2 Region: 69-108
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000379
Family Somatomedin B domain 0.0014
Further Details:      
 
Domain Number 3 Region: 27-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000112
Family Somatomedin B domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S3FKZ1
Sequence length 1140
Comment (tr|A0A1S3FKZ1|A0A1S3FKZ1_DIPOR) LOW QUALITY PROTEIN: proteoglycan 4 {ECO:0000313|RefSeq:XP_012877248.1} KW=Complete proteome; Reference proteome OX=10020 OS=Dipodomys ordii (Ord's kangaroo rat). GN=Prg4 OC=Heteromyidae; Dipodomyinae; Dipodomys.
Sequence
MAWKLLPICFLLLLSASLIEQVSSQDLSSCAGRCGEGYSRDATCNCDYNCQHYMECCPDF
KKVCTVELSCKGRCFESFARGRECDCDSQCKKFGKCCADYENFCEELHNPTSPPPSKTAP
PPPEASQTIKSTTKRSPKSPKKKTKKVVESEEITEEHSVSENQESSSSSSSSSSSIRKVK
SSKNSAANRELQKKPKAKDKKSPKKTPKPEPPVVDDAGSGLDNGDSKPTPTPAVTTTPVK
PANPKPSLPPKSDVPKEASSTNNKETTVTTKESTATNKQTSTSAKEKTTSAKETRSAEKS
SEVPAKPTPKAEMTTKAPALPATTKEPVPTTTKEPAPTTPKEPAPTTTKEPXTTPKEPAP
TTTKEPAPTTPKEPAPTTKEPAPTTAKEPAPTTKEPAPTTAKEPAPTTTKEPAPTTPKEP
APTTTKEPAPTTPKEPAPTTTKEPAPTTPKEPAPTTTKEPAPTTPKEPAPTTTKEPAPTT
PKEPAPTTTKEPAPTTPKEPAPTTTKKPAPTTPKEPAPTTTKEPAPTTPKEPAPTTTKEP
ISTTTREPVPTIPEEPAPTTPDKPVPTTPEKLAPTTPEKPVSTPTPTTPKKPVPTTPGKP
APSSPKTPAPTTTTEPSTTQKNPEATPEFPADPTPKAPDNSPKEPAVLTTKSPEMTTVGK
DKTTEKDIQTTPATPKMTTKETTTEEKTTESKTTSTTMQVKPTAPQDASVKVTTLKPKVT
TAAEETMNNPEETTPGSEETTTNAKTTPKPQKPTKAPKKPKKPAKAPKKPTSTKKPSTQV
KKPKTTPTPPKMTSTVSELNPTSVAETMLQTSPSQTPNSDMAGVNPNNEDTDGDGVEAGN
PHLIPSPPVLAPLVIPGTDHLVRGPNQDIYINSMTSDETNLCNGKPVDGLTTLRNGTLVA
FRGHYFWMLNPFRPPSPPRRITEVWGIPSPIDTVFTRCNCEGKTFFFKDSQYWRFTNDIK
DEGYPKPIVKGFGGLTGKIVAALSVAKYKNRPESVYFFKRGGNIQQYTYKQEPTQKCSGR
RPTINYSVYGGAAQVRRRRFERAIGPAQTHTIRIHLSPVRVSYQDKGFLHNEVKVNTMWR
GFPNVVTTALTLPNIRKPDGYDYYAFSKDQYYNIDIPSRTARAITTRSGQTLSKVWYNCP
Download sequence
Identical sequences A0A1S3FKZ1
XP_012877248.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]