SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1S3FRW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3FRW7
Domain Number 1 Region: 690-837
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.06e-40
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1016-1106
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.78e-29
Family Ras-binding domain, RBD 0.0008
Further Details:      
 
Domain Number 3 Region: 222-372
Classification Level Classification E-value
Superfamily PH domain-like 2e-21
Family Phosphotyrosine-binding domain (PTB) 0.01
Further Details:      
 
Domain Number 4 Region: 7-95
Classification Level Classification E-value
Superfamily PDZ domain-like 8.02e-20
Family PDZ domain 0.01
Further Details:      
 
Domain Number 5 Region: 962-1030
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000475
Family Ras-binding domain, RBD 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S3FRW7
Sequence length 1363
Comment (tr|A0A1S3FRW7|A0A1S3FRW7_DIPOR) regulator of G-protein signaling 12 {ECO:0000313|RefSeq:XP_012879308.1} KW=Complete proteome; Reference proteome OX=10020 OS=Dipodomys ordii (Ord's kangaroo rat). GN=Rgs12 OC=Heteromyidae; Dipodomyinae; Dipodomys.
Sequence
MFRAGEPGRRLAGPAPPRVRAVEVARSRAGYGFSLSGQAPCALSCVMRGSPADFVGLRAG
DQILAINDINVKKASHEDVVKLIGKCSGVLRMVIGEGAGHGRHAESCSSDDETGLYHGKG
WLRPKLDSRALGINRAERVVEEVQSGGIFNMMFESPGLCAGSPEPSRLKQRSLSESAAVG
LAPSQDSPSTPRPGLPLKDEMAQTTGDDSVSAGGLEGHSHDAFGLDASILNVAMVVGYLG
SIELPSTSSNLETDSLQAMRGCMRRLRAEQKIHSLVTLRVMHDRVQLCTDRAGVVAEYPA
EKLAFSAVCPDDRRFFGLVTMQTNEDRGPAQEAEGTLRTSCHVFMVDPDLFHHRVHQGVA
RRFGFACTADPDTGGCLEFPSSSLPVLQFISVLYRDMGELMEGVRARAFLDGDADAHQNH
STSSNSDSGIGNFNQEEKSNRVLVVDLGGASNRHSQGGGPPWEGAGGRSSQPWGAPWNGT
FCHDPEGGSLFETGAQADRFRDLARHSGPTSHGEVPPASLRSSMPPSRRGASSQRWLPVH
VLQEWQCGHASDQESYTDSTDGWSSVNCGTLPPPMSKIPADRYRVEGSLPQAAPRAQKRD
WSRKAFGMQNIFGPHRNIRKTKEDKKGSRFGRGIGLAQTSQRTSARRSFGRSKRLSITRS
LDDLESATVSDGELTGADLKDCVSNHSLSSNASLPSVHSCRRLCERRVASWAVSFERLLQ
DPVGVRYFSDFLRKEFSEENILFWQACEYFNHVPAHDKKELSYRAREIFSKFLCSKATTP
VNIDSQAQLADDVLNAPHPDMFKEQQLQIFNLMKFDSYTRFLKSQMYQECVLAEVEGRAL
PDAQPVPSSPASKQSLSSEHSSASTPKKLSGKSKSGRSLNEDAGDEDSEKKRKGAFFSWS
RNRSTGRSQKRREQGDHAHDALRANGSLCRRESQGSVSSSGSVDLPEACRTPAAERDKAA
RHCCIHLPDGTSCSVAVRSGFSIKDILAGLCERQGINGAAVDLFLAGGDKPLVLHQDSSI
LASRDLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLDLGSLLVRLSGE
KEPLDLGAPISSLDGQRVVLEEKASAAIKLILVLASTDKQKGAPGKQKAAPSSSPRSHAA
TGEERTLGKSNSIKIKGENGKNARDPRLSKREESIAKIGKKKYQKINLDEAEEFFELISK
AQSNRADDQRGLLRKEDLVLPDFLRLPPGSTEPASAKGFSERTAAIHGRGRVARRGDSWE
PAPDPSDSPATSPGSAQSPSSAHSAPEPPGAPQSPSPRQDGTAQVWRRPSPDAEAGGIQT
VEDEHVADLTLVAEGDISSPNSTLLPPSPQDLPGPPKPGTSKF
Download sequence
Identical sequences A0A1S3FRW7
XP_012879308.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]