SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1S3FXJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3FXJ7
Domain Number 1 Region: 481-736
Classification Level Classification E-value
Superfamily YWTD domain 5.49e-57
Family YWTD domain 0.00000312
Further Details:      
 
Domain Number 2 Region: 180-419
Classification Level Classification E-value
Superfamily YWTD domain 5.36e-50
Family YWTD domain 0.00000341
Further Details:      
 
Domain Number 3 Region: 784-1042
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-39
Family YWTD domain 0.0000389
Further Details:      
 
Domain Number 4 Region: 1-129
Classification Level Classification E-value
Superfamily YWTD domain 1.23e-28
Family YWTD domain 0.0000444
Further Details:      
 
Domain Number 5 Region: 738-785
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000614
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1174-1212
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 7 Region: 436-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000105
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 8 Region: 1096-1134
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1136-1172
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 132-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000033
Family EGF-type module 0.009
Further Details:      
 
Domain Number 11 Region: 1053-1106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000634
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S3FXJ7
Sequence length 1465
Comment (tr|A0A1S3FXJ7|A0A1S3FXJ7_DIPOR) low-density lipoprotein receptor-related protein 6 {ECO:0000313|RefSeq:XP_012880567.1} KW=Complete proteome; Reference proteome OX=10020 OS=Dipodomys ordii (Ord's kangaroo rat). GN=Lrp6 OC=Heteromyidae; Dipodomyinae; Dipodomys.
Sequence
MYWTDWGEVPKIERAGMDGSSRLIIINTDIYWPNGLTLDYEERKLYWADAKLNFIHKSNL
DGTNRQAVVKGSLPHPFALTLFEDTLYWTDWNTHSILACNKNTGEGLREIHSNIFSPMDI
HAFSQQRQPKATNPCGVDNGGCSHLCLMSPLKPFYQCACPTGVRLLENGKTCKDGATELL
LLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPAEGYVYWTDDEVRAIRRSFIDG
SGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAI
VLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGTIYWGDAKT
DKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHKRSAERETIIDQ
LPDLMGLKATSVHRIIGSNPCAEENGGCSHLCLYRPQGLRCACPIGFELISDMKTCIVPE
AFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFM
NGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPR
ALALDPAEGFMYWTEWGGKPKIDRAAMDGGERTTLVPNVGRANGLTIDYAKRRLYWTDLD
TNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQG
HLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNADNRTCSA
PTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNVIRK
AQEDGSQGFTVVVSSVSSQNLEIQPYDLSIDIYSRYIYWTCEAANVITVTRLDGRSIGVV
LKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPVALALDS
RLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKID
MTGREGRTKVQARIAQLSAIHAVKELNLQEYRQHPCAQDNGGCSHICLVKGDGTTRCSCP
MHLVLLQDELSCGEPPTCSPQHFTCFTGEIDCIPVAWRCDGFTECEDHSDELNCPVCSES
QFQCASGQCIDGSLRCNGDANCQDTSDEKNCEVLCLIDQFRCANGQCIGKHKKCDHHVDC
GDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTIYFICQRMLCPRMKGDGETMTN
DYVVPGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSSGPPYDRAHVTGASSS
SSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTP
CSTDVCDSDCAPSRRVASVASAATAKGYTSDLNYDSEPAPPPPTPRSQYLSAEENCESCP
PSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences A0A1S3FXJ7
XP_012880567.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]