SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1S3JI08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3JI08
Domain Number 1 Region: 1175-1299
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.49e-39
Family Regulator of G-protein signaling, RGS 0.0000589
Further Details:      
 
Domain Number 2 Region: 1466-1553
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.65e-22
Family Ras-binding domain, RBD 0.0034
Further Details:      
 
Domain Number 3 Region: 16-100
Classification Level Classification E-value
Superfamily PDZ domain-like 1.86e-19
Family PDZ domain 0.033
Further Details:      
 
Domain Number 4 Region: 431-550
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000197
Family Phosphotyrosine-binding domain (PTB) 0.0091
Further Details:      
 
Domain Number 5 Region: 1409-1477
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000011
Family Ras-binding domain, RBD 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S3JI08
Sequence length 2295
Comment (tr|A0A1S3JI08|A0A1S3JI08_LINUN) uncharacterized protein LOC106173091 isoform X2 {ECO:0000313|RefSeq:XP_013409534.1} KW=Complete proteome; Reference proteome OX=7574 OS=Lingula unguis. GN=LOC106173091 OC=Lingulata; Lingulida; Linguloidea; Lingulidae; Lingula.
Sequence
MHAPQQQQQRRRKKRPVPHGLKTVEIGRGRSGYGFTISGQHPCILSCVVAGSPAERAGLR
TGDFVMSVNNQDVSQANHDDVVRLIGSSTGVLVVQIVENNYSSASSDDENYTKKQKAKYP
HRNRPRHSNNANSDGNKANRAEKVLADLESGALFTEPLPVVGKQGHQHRRGVTHNGLPQK
NRSHSPDVERVLRANQRARSPELDRFARANHRSHSPDVERFLRERYRSHSPEADKYLKSR
QRSHSPDVERYLREQQRNYEQRQGYHHQRSKTNHLPVGNGHLQDRPLNNGLQQERKSRRD
IIEPGPFSGNRNNVPVQVHAAMSAQAAGPSVDQRPKVRGNQAAASQEQRPRGRGNTAGAC
ASGEQRPKVRTNPEGAKSPISPAGYQTVFTPQELSNILYPSLQPHLDPLNGLDDNLPQAA
ENNRDNELNLRVVVGYVGSIEMPSDSNMPNSRLQSIRSAIRRLRVEQKIHTLVLMEVFSD
GVKLTNSMGMTVAHYPADRLAFSGVCPDDKRFFGLVTMHSASSDEISSDNGSQAEEEQHG
SSCHVFMVDPELRAHNIHAKKAKAFGFQCTHDPETNKCLEFPRSATPILRTVAKLYKDRV
GGLYEAEIARANMFADPNVAAHRSNSNSSNSDSGLGFWREDGSNGDMVYVVDMPHYNHEY
GHHPRWFYDRQAAGSPPPPGPHGHRSGQPDHGRALSPPPPPPPQHHHHHRSGPSEPGHAF
RRVEQRKSSDSTSPQSAGSTQVSPSGANPPVLDRLNLRAMPDPNVHKLSPSRESLDARTS
AENLRKSMHKYLQTRQKIVVDTNQQTSSDQESHKSSVDLTSKDGHVSGPPQQDAKFNLKQ
RPLSCPIENTPLMPHVPRVGALKVETVDLANKLSPRACITPGPDMFKAANFHSNSTNSIN
EITPTNTTASSSTEKQSDLDMPDALDVPEERNEKKHKKKKNSNDGEFKIPSHPVKQNNNK
SKQKDENTRESLPSSSSNSNQAAVQKMVARFEKEKPIPPKKPDLTKRNLPVSANSKADAE
ISQDSDKLKQTQGDGDKLSRGDGYSQKNPNRMSHDGASQRDPQPPPNGASRGGVQENHKD
QSQKAAHPHLEVRRFSEVTIPNFKQPEDDPHWRRSSQGAFKKQSSAPKMPHSQSHESLAI
SDAEFPLSGKMASASSVTSVASDASIHVDVCQSDLGRVAGWAVSFEKLLADPAGQATFTE
FLKKEFSEENMLFWITCEKFKKISSPAQMKVRAQEIFSCHLATGATEPVNIDSVARKRAA
ECLENPVPDMFDMSQQQIFRLMKTDSYVRFLKSDMYKECVVAEMEGRHLPYQPEDSDEDK
RKLRKKASTDGEEDGKRRKSLLPWKGKGSKRPSGKGSTGSTSDSERKGTMKSSLASADLS
MMSKEITGSQESLNKDDTSSQGDNKENYKLCRVILPDGATTVIYAKPGQTVKDAVLSLCE
KRGLILATLDVLIVGSEKALDLRKDISSLGSKEIKLESRVLFRLDMPNNKSIGVKAKPTR
TVKEVFKPILNKYGYKIENMAMFVAGLGHPLDPNMLVSVVENQRVIVQPAEDFAEWGGGY
ELHRTSIGKPPLPRQRHSVPAPPLASKEDASGNAFQEMIEGKGDCLNGFDELGILDLDRN
AKTDDRSSSNRSSGIFSLIRRNSVGDKIQSKKSKEKVGIPTSSSANSGIATQRNSMIKKD
GANGTAVKKKRSNAEDASFKQLVSGVKAMQTSRLDDQRGLLLSQPELPDFLKKPAHSSSD
KENSPNAGNRHSEIFPQRQESEPSYIYGGGPSSQDSIDSHLMKSTSQPSLASDHSSRSAG
SRGSSSSTGDRRSLKTFHTFGHLSPGDFPAHLDTSFSGEGILPSHLEAEEYFDQAYRYPS
ELNERGLSDYDLDSSAHSSLFTNSQSRDSFPFHGDSQDSFPMGHPGGDRFSYGSDCRSSS
SSRGSVGNSKRTTTTRSYSEDPGNYKLADNRFSMEDKNVGKTKPPPPPPKPQRSLSQQDS
SPQTPKAYSRVFEEISSPVTPGLNRTVIENYTEITEADLDATLIAAQQSPRPDSVPPPPP
SVMDGSLTEFQEADFPPPPPVTGNTGKPWEISIIQHDSGGEEQFRSPYSRRFPRSQSCEA
QKGGKETHVLQNTRGRSSSYHHHSSFSDEGDIGTDTEPANCSAETTSNTSRLSPPASTPS
PTTHDLLPLDSPSPKARTRLDFTSNAYNPNPAAASHAIKYNHHSAYSGQGRQPSVQPAPS
YHSTTGGSTYPALQRSPVGVSAVQNRQPAPYVPPPSYSKSMARPELRTAAVRKTGVSSGP
YDQGQQRSDVKITFV
Download sequence
Identical sequences A0A1S3JI08
XP_013409534.1.76062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]