SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1S3KIT2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3KIT2
Domain Number 1 Region: 528-664,693-764
Classification Level Classification E-value
Superfamily Hemopexin-like domain 9.68e-40
Family Hemopexin-like domain 0.0013
Further Details:      
 
Domain Number 2 Region: 76-114
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000484
Family Somatomedin B domain 0.001
Further Details:      
 
Domain Number 3 Region: 35-74
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000876
Family Somatomedin B domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S3KIT2
Sequence length 766
Comment (tr|A0A1S3KIT2|A0A1S3KIT2_SALSA) proteoglycan 4-like {ECO:0000313|RefSeq:XP_013978510.1} KW=Complete proteome; Reference proteome OX=8030 OS=Salmo salar (Atlantic salmon). GN=LOC106560287 OC=Salmoniformes; Salmonidae; Salmoninae; Salmo.
Sequence
MLLLRLKQRTPVKMTPSGLSALLLLACALPFNSAQSSCSGRCGGEYYRGYMCQCDYDCHT
HEECCKDYESQCTTSDSCKGRCGESFKRGRQCDCDPDCARYSKCCPDYKSQCGIEEPEPP
QIQPNEEPEMTPNPQEELNEDDQFMPLVTPEPELQDEQGDDVKGETWPDLPVPSPEQEAI
LEGDYTAFPEELDPEATPGQEGTPPAEANLNSYLAEPAKEVPTETADSSVPEGQPDSSSS
PSALNTTPHESSSEPTPASPQLSDQVFPSSEPQPGPTPAEDTLELLSEGQSELDPEGQEA
ESENTLPKDSEPTPSNLENAATTPASDPVSTSPTQGTPSGPEDPEATPASLDSTTPSTKP
DQTPSAPKGATPSSEQDSSKENAPTTTPSDPQDPNAASEAPASESGPEAKPGRGDTPDSF
DANSVPQTGDLAMPPTSDPQATPTDPTGHEEEGDEAAPEETTTDPMKLTLVPTIKPTPNK
TTEKPKPSKPTGKPKPRPTRPSTLTDINQDLGTDNPRDYQADEHNDTNICSGRPVGAVTT
LRNGTVVVFRGHYFWVLDSNRVPGPARGITDVWGVPSPIDTVVTRCNCQGKTYFFKGSNY
WRFENGMMEPGYPKLIRVGFDGLQGQITAALSVPEYRKRRESVYFFKRGGLVQKYSYQSG
TSPTCGRKVHYSVYTVRNRVARQAVPLLGQEINIRQTWRGFPSTVTSAVSIPTHRKPEGY
NYYLFSRSKYYNVNMGDERPFIATPPVSAAPQKNSAKDFFNCPKKV
Download sequence
Identical sequences A0A1S3KIT2
XP_013978510.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]