SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1S3LXP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3LXP9
Domain Number 1 Region: 1181-1312,1345-1389
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.96e-30
Family Hemopexin-like domain 0.00087
Further Details:      
 
Domain Number 2 Region: 77-118
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000523
Family Somatomedin B domain 0.0012
Further Details:      
 
Domain Number 3 Region: 36-74
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000301
Family Somatomedin B domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1S3LXP9
Sequence length 1414
Comment (tr|A0A1S3LXP9|A0A1S3LXP9_SALSA) proteoglycan 4-like {ECO:0000313|RefSeq:XP_013995409.1} KW=Complete proteome; Reference proteome OX=8030 OS=Salmo salar (Atlantic salmon). GN=LOC106569000 OC=Salmoniformes; Salmonidae; Salmoninae; Salmo.
Sequence
MVGPLLKLKVMMTASSLLAALVVVTCAALLPFSAAQTSCSGRCGDPFTRGQPCQCDASCL
THDECCKDFEAHCTFGESCSGRCGESFRRGRLCDCDPGCVRYDTCCRDYQNHCDATTTPP
ATQRIKPDAKKKPTVPPKNKPISETEFKSLKSPKKPSNSESEESSQDQSQTIYPSPSDLF
PETQDYDTNGPYPGSSSPKSQSHYSLFSEDPASPLNPDFYPLTDSFNGPSSTAPATVMDA
LSDAATSLLEGISPLLPTPMATTPSALPSFTGQLPGPANFPSTGLPMPSHGGPSAGNAGP
RALLSGPPLLPTLADIAKALGLKNPITLADIAKAMGLNTANDPITLANIAKALGFNNPND
PKPPQNPKNSIVLADIAEAMGLNSPNDPITLANIAKALGFKSPNDPKPRQDPSSLADIAK
ALGLNSPNDPITLANIAKALGFNNSNDPKPPQNPNNPITLVDIAKALGLNSPNDPITLAN
IAKALGFNDPNAPKNPQYPSSLADIAKALGYNINEPITLADIAKALGLKKENNPFTLADI
AKALGLKTPKDPITLANIAKALGLKDPSTLADIAKALGFNNPNDPKPPQTPSYLSDIAKA
LGLNSPNDPITLANIARVLGLNDPNKPITLADIAKALGLNDSSKLADIAKALGVKNSNKP
ITLEDIAKVLGFKNPKDPKHSGRCSQGLGAQRPLHTHHSGRHSHGVGTHPNDPKRPSNSN
TLADIAKALGLNDPNKPITLADIAKALGVNNPNDPKPPQNPNEPITLADIAKALGLKTPN
NPFTLADITKALGLKTPKDPITLANIAKALGLKDPSTLADIAKALGFNNPNDPKPPQNPS
YLSDIAKALGLNSPNDPITLANIARALGLNDPNKPITLADIANALGLNDSSTLADIAKPL
GVKNPNKPITLADIAKVLGFKNPNDPKTSQNPNTLADVAKALGLNDPYTPITLADIATAL
GLSDPSTLADNRNTLADIAKALGLNNPNDPITLANIARALGLNDPNKPITLADIANALGL
NDSSTLADIAKPLGVKNPNKPITLADIAKVLGFKNPNDPKTSQNPNTLADVAKALGLNDP
YTPITLADIATALGLSDPSTLADVAKALGVNSPNDPKKPSNRNTLADIAKALGLNDPNKP
ITLADIAKALGLKDPSTTAEITKSLGYNNPNTGLPDADSNPDLCSDLPINGLTTLANGTI
LIFKGHFFWTMDPITKDHGPARNITEELGIPSPIDSAFTRTNCQDKSYIIKGDDYWGMDN
GNMEPGYPKSVASGFHGLTGTITAALPVPATRRRPESVYFFKKGGTMQKYSYHAGSSTVC
GRKSKSSTKKRHARQTEMSLGAEINIKLALKGFPSSVTSAVSVPSPKKADGYDYFLFAGP
LYFNIKISGDLPALAKPDNADPRQNSIKKWLKCI
Download sequence
Identical sequences A0A1S3LXP9
XP_013995409.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]