SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1S3N6S4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3N6S4
Domain Number 1 Region: 707-831
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.23e-38
Family Regulator of G-protein signaling, RGS 0.00011
Further Details:      
 
Domain Number 2 Region: 1022-1119
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.21e-27
Family Ras-binding domain, RBD 0.0011
Further Details:      
 
Domain Number 3 Region: 22-101
Classification Level Classification E-value
Superfamily PDZ domain-like 4.73e-19
Family PDZ domain 0.007
Further Details:      
 
Domain Number 4 Region: 209-325
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000492
Family Phosphotyrosine-binding domain (PTB) 0.035
Further Details:      
 
Domain Number 5 Region: 968-1036
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000964
Family UBX domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S3N6S4
Sequence length 1476
Comment (tr|A0A1S3N6S4|A0A1S3N6S4_SALSA) regulator of G-protein signaling 12-like {ECO:0000313|RefSeq:XP_014011193.1, ECO:0000313|RefSeq:XP_014011195.1, ECO:0000313|RefSeq:XP_014011196.1} KW=Complete proteome; Reference proteome OX=8030 OS=Salmo salar (Atlantic salmon). GN=LOC106577570 OC=Salmoniformes; Salmonidae; Salmoninae; Salmo.
Sequence
MATFRMPGQNDRARRRLNLTAPQEVRGVEVVRGRVGYGFTLSGQGPCVLSGILEGSPADL
LELKQGDCIVSVNGINVVKASHEAVVQLIGTCKGPLRLVVLVGTGPTVDPSSSKEELGLS
RTEGKGLFQKGGVFQTVLDHSGNSSCNSVTPFKPRPLSEPDMSHWTQPWNSKIQPGFLSE
EETAKVADIDSVFNDQENNVNPDWSMLNTAMVVGYLGSTELILALSSPSSEDDCLQLIRR
CIRRMGIEQETHTLVMIKIMFDCVRLCDDAGAVLAAFPSENLVVGVVCSEDRRFFCLVTT
AHVSGGHVGKNGPLRSSCHVFFIDPELCHHSDHLGIAGRFGFDCTPDTQGCQEFPLTPPS
VLQFVSVLYCNMGEAVERLRTRLDRESAHHLHTRQNSSRACKNGSASSNRDSGIGNASPP
EERPDRDFPVAHGTKPGGNLPSCPWEDYPQAEANHTQIVAHQNGRLNLNGHPNPGSTHSL
SESLPGPASLTGPSGGPPPKLEFQFKPPPPPYPVGKIQNLTEGGGPFRSSQRRFSMSVKQ
RWPRGHSGEPEPQATPATNSWSGPATVGCTNALPPPTSQIPPDRYQAAEAMMLLPQREEW
TKQLWRAESGELLNGKPRRDANTKGSKFWGIGAGRSSGRRFSGRRSFGHPKKLSLARSLD
DLESTASSDADYGGGVQLQGCCSQSSLNSNSSLPGASSHKRLSERRVASWAACFERLLQD
PIGVCYFSEFLKKEFSEENILFWQACEYFSQVPATDKKQLSQRAGEIYNSFLSSKATTPV
NIDSQAQLADDVLTSPCPNMFKAQQLQIFNLMKFDSYSRFLKSGLYQECMLAEVEGRPLP
DPYQIPCSPAPSKHSASSGHSTPNKEARNQKSGRSLNEDPGDEHDEHKKRGIFFSWSRNR
SFGKGPKKKDIGEMNIDSWGSNGRRESQGSLSSGASLELATSCSTGKTEGDNRHSVPVWE
RVRECSKICSMTLPDGSCSSVTLRPGATIREVLRDLCQSLRINMAAVDLFLVGGEKPLVL
DQDCMTLSARDLRMEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLHLKDLV
AKISGETEPLDLGAPISSLDGLRVVLERADPVASGKDSKSKSGSLKAHPPSLTTKSLSAT
GDDRSSGKASGPDPSLPAEKRKPKKINIDEAEEFFELLSRAQSNRRNDQRGLLNKEDLEL
PDFLRLTSGSPSTASLDKACSTPTSVKQGQGPGRENGVGGAPARGPLNASLRSESLDSSL
SSTNGHSQSAAGRRALLPPPRRPVPPFSATLSPIPRPSESRGPALRMLEEDTHADLTLVG
EGDITSPNSTLLAPALLSHEGSLPEGNFIPPSPCAHSFHDGGGNGQSSSERRQRACALDR
SHKRSPCLGALRSQPALQEVMDVEGVCLEEEEEEKVREVTITHGEDSELSVSFQGYAAEL
RQCQSRMKTSQVPLNTHDQSEGNKDSKTDTYKATIV
Download sequence
Identical sequences A0A1S3N6S4
XP_014011193.1.97760 XP_014011195.1.97760 XP_014011196.1.97760 XP_014011197.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]