SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1S3PAE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3PAE6
Domain Number 1 Region: 512-648,677-748
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.27e-38
Family Hemopexin-like domain 0.0013
Further Details:      
 
Domain Number 2 Region: 62-100
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000458
Family Somatomedin B domain 0.00098
Further Details:      
 
Domain Number 3 Region: 22-60
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000575
Family Somatomedin B domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S3PAE6
Sequence length 756
Comment (tr|A0A1S3PAE6|A0A1S3PAE6_SALSA) proteoglycan 4-like isoform X2 {ECO:0000313|RefSeq:XP_014024517.1} KW=Complete proteome; Reference proteome OX=8030 OS=Salmo salar (Atlantic salmon). GN=LOC106584136 OC=Salmoniformes; Salmonidae; Salmoninae; Salmo.
Sequence
MTPSVFFALLLACALPFNSAQLSCNGQCGGEYNRGYMCQCDYDCLTHNECCIDYESQCTT
SESCKGRCGESFKRGRLCDCDPDCARYKKCCPDYDSQCGIEEPEPEPEPEPEPPQIQPTE
EPEMTPDPQEELSEDVKGETWPDLPVPSPDTGSEDPDASPYPEDPEAGLVDPEATANPDD
PEETPASESTSGSELSPTEPASSDPLDPTLDTIPQPTDTEDDPEKEAILKGDYTPFPEEL
DTEATPGSEGTPPAANPNPSTAEPANETPAEATDSSDPEGQPYSSSSPSAAIPTLPGSTS
EPNPASPVAPQPPDQASDQASDQPPDQASPSSEPQPGPTPAEDTPELQPEGQSELDPEGQ
EAESENTVPDESEPTPSNLQDPNLISEAPTSESGPESKPGRGDTPNHFNDNSVPQTGDLA
THLTIDPAGQEEGDEAAPEETTSNSMKLTPTPTPIPTTKPTQNKLTEKTKPSKPTEKPKP
KSTQPNTLTDINQSLGTDNSRDYQADEHNDTNICSGRPVGAVTTLRNGTVVVFRGHYFWA
MDSNRMPGPAQRITDVWGVPSPIDTVFTRCNCQGKTYFFKGANYWRFENSMMDMGFPKLI
SVGFNGLQGQITAALSVPEYRKRKESVYFFKNGGLVQKYSYQSGTSPTCNRKAHYSVYTV
HNRIARQAVSLLGQEINIRLTWRGFPSTVTSAVSIPTHMKPEGYNYYLLSRSKYYNVNMR
DERPFIATPPVSAAPQKNSAKDFLNCPKEVRKNSQE
Download sequence
Identical sequences A0A1S3PAE6
XP_014024517.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]