SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1S3SD05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S3SD05
Domain Number 1 Region: 687-834
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.66e-37
Family Regulator of G-protein signaling, RGS 0.0000884
Further Details:      
 
Domain Number 2 Region: 1020-1117
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.73e-27
Family Ras-binding domain, RBD 0.0012
Further Details:      
 
Domain Number 3 Region: 19-98
Classification Level Classification E-value
Superfamily PDZ domain-like 5.39e-21
Family PDZ domain 0.0045
Further Details:      
 
Domain Number 4 Region: 208-324
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000157
Family Phosphotyrosine-binding domain (PTB) 0.039
Further Details:      
 
Domain Number 5 Region: 965-1034
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000093
Family Ras-binding domain, RBD 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1S3SD05
Sequence length 1373
Comment (tr|A0A1S3SD05|A0A1S3SD05_SALSA) regulator of G-protein signaling 12-like isoform X2 {ECO:0000313|RefSeq:XP_014062219.1} KW=Complete proteome; Reference proteome OX=8030 OS=Salmo salar (Atlantic salmon). GN=LOC106608656 OC=Salmoniformes; Salmonidae; Salmoninae; Salmo.
Sequence
MRMPGQAEGARRRLDLTSPHEVRRVEVVRGRVGYGFTLSGQGPCLLSGILEGSPADHVGL
KQGDRIVSVNGTDVAKASHEAVVQLIGTCKGPLRLVVLVGSGPSVDLSSSDEELRISRTE
GKGLFQKGGVFRTVSDHSGNSSSNSVNATPAKPRPVSEPDMSHWIQPSNSKTQPVFLSEE
ETARVADGDSVFNEHEDDVNRDWSILNTAMVVGYLGSTELILALSRHGSEDDCLQVIRGC
IRHLGTEQETHTLVMMKIMFDCVRLCDDTGAVLAAFPSENLVLGVVCSEDRRFFCLVTTA
HISGGHVGQNGPLSTSCHVFFIDPELCHHSDHLGITGRFGFDCTPDPDTQGCLEFPLTPP
SVLQFVSVLYCDMGEAVERLRTRLDRDSAHHLHTQQNRSSTGKNGSASSNGDSGIGNTSP
PEERADRDFPIARGNDPGGQLPSCPWEDYPQAEGDLTQIVANQNGCLKLNGHPNPGSTNS
LSESLPGPASLTGPSGGPPPRLEFQFKPPPPPYLLAKNQKQNLTGGGSFRSSQRWFSMSV
KQRWPKGRGGEPESQATPATNSWSGPATVGSTNALPPPMSQIPPDRYLAAETMMLLPQRE
EWAKRLWRVESGELLNGNPRKDANTKGSKFWGIGAGRSSGRRSFGHSKRLSLARSLDDLE
SAASSEGDHGGGVQLQGCCSQSSLNSNGSLPGAGSLRRLSERRVASWAACFERLLQDPIG
VRYFSEFLKKEFSEENILFWQGCEYFSHIPATDKKQLSQRAGEIYNSFLSSKATTPVNID
SQAQLADDVLTSPCPNMFKAQQLQIFNLMKFDSYSRFLKSGLYQECMLAEVEGRPLPDPY
QIPCSPAPSKHSASSSLSLSTPIKEARKQRSGRSLNDDPGEEHDEHKKRGTFFSWSRNRS
FGKGPKKKDIGEINLDSWSSNGRRESQGSLSSGASLELATSCSAGKIEGDNRHSVPVWDR
VSSAKHCNVTLPDGSCSSVTLRPGATIREVLRVLCQKLCINMVAVDLFLVGGEKPLVLDQ
DCMTLSSRDLRMEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLHLNDLVAK
ISGETEPLDLGAAISSLDGLRIVLERADPSASGKDSKSKSASLKAHLPSLTSRSLSATGD
DRSSGKASGPDPSLPTEKRKPKKINIDEAEEFFELLSRAQSSRRNAQRGLLNKEDLELPD
FLRLTTCSPSTASLGATCSTPTSIKQGQGAGRVNGMGGTPARGPLNASLRSESLDSSLSS
ANGHSHSAVGRRALPPARHPIPTFGATLSPIPRLLEARGPGLRTLEEDTHDDLTLVGEGD
INSPNSTLLPPSPMPLSHEASLPEANFTPPAPCAQTSQDGCGNGQPSSGISTL
Download sequence
Identical sequences A0A1S3SD05
XP_014062219.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]