SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1S4D156 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1S4D156
Domain Number 1 Region: 106-172
Classification Level Classification E-value
Superfamily Rubredoxin-like 3.53e-20
Family Rubredoxin 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1S4D156
Sequence length 205
Comment (tr|A0A1S4D156|A0A1S4D156_TOBAC) rubredoxin-like {ECO:0000313|RefSeq:XP_016507121.1} KW=Complete proteome; Reference proteome OX=4097 OS=Nicotiana tabacum (Common tobacco). GN=LOC107824830 OC=Nicotianoideae; Nicotianeae; Nicotiana.
Sequence
MASATARASFTFTPNSLTQPSSPKPKPHLTFPPFHLKSHSISSFYRNPIRTQSFSSLPKS
IDVSKEDKPISEQPTSETPTSEPEQQEEEEDKFDKRRLEEKFAVLNTGIYECRSCGFKYN
EAVGDPSYPIPPGLPFDQLPADWRCPTCGAAKSFFDNKSVEIAGFAQNQQYGLGGNTLTS
GQKALLIYGGLLLGFVFFLSGYFLQ
Download sequence
Identical sequences A0A1S4D156
XP_016507121.1.3737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]