SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1U7EW27 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7EW27
Domain Number 1 Region: 14-77
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000185
Family HxlR-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1U7EW27
Sequence length 107
Comment (tr|A0A1U7EW27|A0A1U7EW27_NATPD) Homolog to phage PhiH1 repressor protein {ECO:0000313|EMBL:CAI49273.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_2364A OC=Natronomonas.
Sequence
MRRSAEWMVLCDERILEYLSENESGTPSEMANSGRVRWTRSYISQRAKKLVDHGLLKHLG
NGVYIITDEGEAYLDEEYDAERGAYLDRNVADADSDGAESAGEANGT
Download sequence
Identical sequences A0A1U7EW27
348780.NP2364A WP_011322899.1.57290 gi|76801825|ref|YP_326833.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]