SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1U7EWN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7EWN2
Domain Number 1 Region: 9-105
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.28e-30
Family HxlR-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1U7EWN2
Sequence length 108
Comment (tr|A0A1U7EWN2|A0A1U7EWN2_NATPD) HxlR family transcription regulator {ECO:0000313|EMBL:CAI49497.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_2812A OC=Natronomonas.
Sequence
MSNTQRRLEAACPVVESMDQIGSKWRLLVLHDLQHGEKRFNELKRSTGANSRTLSRVLDD
LQETEFVERRLEEDAPVATYYSLTQKGRSLAPVFDEIEEWADEWLEIE
Download sequence
Identical sequences A0A1U7EWN2
gi|76802048|ref|YP_327056.1| 348780.NP2812A WP_011323122.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]