SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1U7EWY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7EWY6
Domain Number 1 Region: 14-69
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000539
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1U7EWY6
Sequence length 97
Comment (tr|A0A1U7EWY6|A0A1U7EWY6_NATPD) HTH domain protein {ECO:0000313|EMBL:CAI49625.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_3068A OC=Natronomonas.
Sequence
MIDRLARQLRKEERDLLVLEIILQQHPIGIERIAEEAGLDEHKTRHSMRMLEDDDLIEPT
PQGAVPTDGVEERIGRIHGGIDSLIDRMEELKQYGNQ
Download sequence
Identical sequences A0A1U7EWY6
348780.NP3068A WP_011323247.1.57290 gi|76802174|ref|YP_327182.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]