SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1U7EY60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7EY60
Domain Number 1 Region: 19-111
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000592
Family TrmB-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1U7EY60
Sequence length 134
Comment (tr|A0A1U7EY60|A0A1U7EY60_NATPD) TrmB family transcription regulator {ECO:0000313|EMBL:CAI50153.1} KW=Complete proteome; Reference proteome OX=348780 OS=NBRC 14720 / NCIMB 2260 / Gabara) (Halobacterium pharaonis). GN=NP_4124A OC=Natronomonas.
Sequence
MANSMSEYLKQDMECEGLLECIHGLKELDKEIFQLLTETAEPMTVDEIADAVDRERSTAY
RSVQRLVQSGFVQKEQVNYDQGGYYHVFRPTDPDEIADDMQRMLNDWYAKMGNLIGEFRE
KYDDPAEQAAVAEN
Download sequence
Identical sequences A0A1U7EY60
gi|76802696|ref|YP_330791.1| WP_011323769.1.57290 348780.NP4124A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]