SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1U7QDY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7QDY2
Domain Number 1 Region: 644-899
Classification Level Classification E-value
Superfamily YWTD domain 1.03e-55
Family YWTD domain 0.00000617
Further Details:      
 
Domain Number 2 Region: 32-292
Classification Level Classification E-value
Superfamily YWTD domain 7.59e-54
Family YWTD domain 0.00000173
Further Details:      
 
Domain Number 3 Region: 343-573
Classification Level Classification E-value
Superfamily YWTD domain 3.4e-50
Family YWTD domain 0.00000251
Further Details:      
 
Domain Number 4 Region: 946-1203
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-38
Family YWTD domain 0.0000694
Further Details:      
 
Domain Number 5 Region: 1334-1369
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000916
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 6 Region: 1296-1332
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 1255-1295
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 902-949
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000123
Family EGF-type module 0.018
Further Details:      
 
Domain Number 9 Region: 599-645
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000002
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 10 Region: 298-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000126
Family EGF-type module 0.013
Further Details:      
 
Domain Number 11 Region: 1213-1265
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000931
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1U7QDY2
Sequence length 1614
Comment (tr|A0A1U7QDY2|A0A1U7QDY2_MESAU) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} KW=Complete proteome; Reference proteome OX=10036 OS=Mesocricetus auratus (Golden hamster). GN=Lrp5 OC=Muroidea; Cricetidae; Cricetinae; Mesocricetus.
Sequence
METAPTRVPPPPLLPLLLLTLCCSLAPAAASPLLLFANRRDVRLVDAGGVKLEATIVASG
LEDAAAVDFQFSKGAVYWTDVSEEAIKQTYLNQTGAAAQSIVISGLVSPDGLACDWVGKK
LYWTDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGEAPRIERAGM
DGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPF
ALTLSGDTLYWTDWQTRSIHACNKWTGEKRKEILSALYSPMDIQVLSQERQPPFHTRCEE
DNGGCSHLCLLSPREPFYSCACPTGVQLQDNGKTCKAGAEEVLLLARRTDLRRISLDTPD
FTDIVLQVGDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGI
AVDWIARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIVLHPVMGLMYWTDWGEN
PKIECANLDGRDRHVLVNTSLGWPNGLALDLQEGKLYWGDAKTDKIEVINMDGTKRRTLL
EDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVG
TNPCADGNGGCSHLCFFTPHATKCGCPIGLELLSDMKTCIIPEAFLVFTSRATIHRISLE
TNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPE
GMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWKDLDNPRSLALDPTKGYIYWTEWG
GKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERMVI
ADDLPYPFGLTQYSDYIYWTDWNLHSIERADKTSGQNRTLIQGHLDFVMDILVFHSSRQD
GLNDCVHSNGQCGQLCLAIPGGHRCGCASHYTLDPSSRNCSPPSTFLLFSQKFAISRMIP
DDQLSPDLVLPMHGLRNVKAINYDPLDKFIYWVDGRQSIKRAKDDGTQPSTLTSPSQSLS
PDRQPHDLSIDIYSRTLFWTCEATNTINVHRLDGDAMGVVLRGDRDKPRAIAVNAERGYM
YFTNMQDHAAKIERASLDGTEREVLFTTGLIRPVALVVDNALGKLFWVDGDLKRIESCDL
SGANRLTLEDANIVQPVGLTVLGRHLYWIDRQQQMIERVEKTTGDKRTRVQGRVTHLTGI
HAVEEVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSP
DQFACATGEIDCIPGAWRCDGYPECADQSDEEGCPVCSASQFPCARGQCVDLRLRCDGEA
DCQDRSDEANCDAVCLPNQFRCTSGQCVLIKQQCDSFPDCADGSDELMCEINKPPSDDIP
AHSSAIGPVIGIILSLFVMGGVYFVCQRVMCQRYTGASGPFPHEYVSGTPHVPLNFIAPG
GSQHGPFPGIPCSKSMMSSMSLVGGRGSVPLYDRNHVTGASSSSSSSTKATLYPPILNPP
PSPATDPSLYNMDMFYSSNIPATARPYRPYIIRGMAPPTTPCSTDVCDSDYSTSRWKTSK
YYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPVTERSYCHLFPPPPSPCTDSS
Download sequence
Identical sequences A0A1U7QDY2
XP_005064154.1.91757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]