SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1U7UFC5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U7UFC5
Domain Number 1 Region: 855-984,1049-1115
Classification Level Classification E-value
Superfamily Hemopexin-like domain 8.59e-38
Family Hemopexin-like domain 0.00092
Further Details:      
 
Domain Number 2 Region: 69-108
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000157
Family Somatomedin B domain 0.0012
Further Details:      
 
Domain Number 3 Region: 27-66
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000017
Family Somatomedin B domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1U7UFC5
Sequence length 1115
Comment (tr|A0A1U7UFC5|A0A1U7UFC5_TARSY) proteoglycan 4 {ECO:0000313|RefSeq:XP_008070974.1} KW=Complete proteome; Reference proteome OX=1868482 OS=Tarsius syrichta (Philippine tarsier). GN=PRG4 OC=Tarsiiformes; Tarsiidae; Carlito.
Sequence
MEWKILPIYLLLLLSVFLIQQVSSQDLSSCAGRCGEGYSRDATCNCDYNCQLYMECCPDF
KRVCTVDLSCKGRCFESFARGRECDCDSQCKEYGKCCPDYESFCAEVHNPTPPSSKAARS
PPGASQIIKSTSKRSPKSPDKKKTKKVVESEEITEEHSVSENQESSSSSSSSSSSSTIRK
IKSSKNSAANKELQKKPKEKGNKKKRTPKKKPTPKPPVTDEAGSGLDSGDVKLTPAPAIP
TTQSNKVTTSPKITTAKPKDPKPSLPPNSDTSKETTLTANKETIVKTKETSKTNKQTSTS
EKEKTTSKETRGAEKTAGKDLAPTSEVPTKPIPKAETTTKAPAPTTTKEPAPTTTKEPAS
TTTTTKEPAPSTTKEPAPTTPEEPKPTTPREPAPTPEEPVPTTTEESGPTTPREPAPTTT
KEPAPTTPKEPKPTTPKEPVPTTTKEPDPTIPREPAPITTKEPAPTTTKRPAPTTPEEPA
PTTPEDPEPTTKAQAPTTTKEPTPTKELAPTTTSEPAPTTTKKPAPTTTKEPAPMIPKEP
TPMMPEEPAPTPPKKPSPTTSETPAPTTAEASTPTTTTQSPTTPKIPAESTPEFSAEPTP
KALENSPKEPAVPTTKTSEVTKPEMTTTAKDKTTAKDIHTTPEITTAAPKITTKETATTT
EEKTAESKLTSITTQVTSTTQETTSLKITTLKATTLAPKATTTTKKTTTTTEETMNKPEE
TAKPKDTATNSKVTTPKPPKPTKAPKKPPPTRKPKTTPRVRKPKTTPTPPKMTTVPELNP
TSVETMFQTTTSPKPTPNSGRVEENPKNADADGAEGEKPHMILRPPVLPPIVIPGMDYLV
RQGIGINPILSDETNLCNGKPVDGLTTLHNGTLVAFRGHYFWKLNPFSPPSPARRITEVW
GIPSPIDTVFTRCNCEGKTFFFKDSQYWRFTNDIKDAGYPKQIVKGFGGLNGKIVAALSI
AKYKNRPESVYFFKRGGSIQQYTYKQEPVSKCTGRRPALNYPVYGETTQVRRRRFERAIG
HAQTHTIRIHYSPVRVVYQDKGFLHNEVKVSTLWRGFPSMVTSAISLPNIRKPDGYDYYA
LSKDQYYNIDVPSRTARAITTRSGQTLSKVWYNCP
Download sequence
Identical sequences A0A1U7UFC5
XP_008070974.1.4292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]