SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A1U8BYW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1U8BYW3
Domain Number 1 Region: 717-860,915-948
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.86e-36
Family Hemopexin-like domain 0.00093
Further Details:      
 
Domain Number 2 Region: 68-107
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000523
Family Somatomedin B domain 0.0013
Further Details:      
 
Domain Number 3 Region: 27-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000667
Family Somatomedin B domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1U8BYW3
Sequence length 954
Comment (tr|A0A1U8BYW3|A0A1U8BYW3_MESAU) proteoglycan 4 isoform X2 {ECO:0000313|RefSeq:XP_012971320.1} KW=Complete proteome; Reference proteome OX=10036 OS=Mesocricetus auratus (Golden hamster). GN=Prg4 OC=Muroidea; Cricetidae; Cricetinae; Mesocricetus.
Sequence
MGWKILPICLPLLLPALLIQQVSSQDLSSCAGRCGEGYSRGATCNCDYNCQHYMECCPDF
KRVCTTELSCKGRCFESFARGRECDCDSQCKEFGKCCADYDSFCEEVKDNKKNTPKKESN
PEPPDVDEAGSGLDNGEPKPTLTPNSPKTTAAKPASVKPSLAPNSETSKEASSASNKETT
VETKETTATNKQTSASKKEKTTSAKEIRSAENKDVAPTSDVPSPTTSKNSAPTTTKKPVP
TTTKEPAPTTTKKPVTTTKEPAPTTPKKPEVTTPTKPAPTTPKEPEATTPKEPAPTTPKS
PEATTPKKPAPKTPKEPEATTPKEPAPTTPKESEATTHKKPAPKTPKEPEATTPKEPAPT
TPKEPKPTTPKEPASTTPKEPEVTTPKEPAPTTPKEPEVTTPKEPAPTTPKESEVTTPKK
LAPTTPKEPDPTTPKEPAPTTPKDPEVTTPKTPAEVTPDFPEVPTPQPVENSPKEATVPP
TKTPKVSEPGMTTAAKEKTTEKDMPQTTTVAPKKTTIVPEETTKSEASAATQVTPASQDT
RSPQISTLKATTPAPKVTAPTEETPNKPEGTTPASEDSDDPKTTLKPQKPTKAPKKPAST
KKPPKAPKKPTSTKKPKTTKGRKPKTTPSPLKTTSAIPELNTTPLELVLPTTTSPNQTPN
SETAAVNPDHEDSDGGDGGKPLIPRPPVLSPIVISGTDHLAGALNHGININTMLSDEMNL
CNGKPVDGLTTLHNGTLVAFRGHYFWMLNPFRPPSPPRRITEVWGIPSPIDTVFTRCNCE
GKTFFFKDSQYWRFTNDVQDAGYPKQIVKGFGGLTGKIVAALSVAKYKDRPESVYFFKRG
GNIQQYTYKHEPMRKCTGRRPAINYSVYGDAAQVRRRRFERAVVPFQTHTFRIHYSPPMR
VAYQDKGFLHNEVKVSTMWRGFPNVVTSVITLPNIRKPDGYDYYAFSKGKQQAF
Download sequence
Identical sequences A0A1U8BYW3
XP_012971320.1.91757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]